Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Myeloblastin (PRTN3), Biotinylated

Product Specifications

Product Name Alternative

AGP7; C-ANCA antigen; Leukocyte proteinase 3; PR-3; PR3; Neutrophil proteinase 4; NP-4; P29; Wegener autoantigen

Abbreviation

Recombinant Human PRTN3 protein, Biotinylated

Gene Name

PRTN3

UniProt

P24158

Expression Region

28-248aa

Organism

Homo sapiens (Human)

Target Sequence

IVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLR

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Serine protease that degrades elastin, fibronectin, laminin, vitronectin, and collagen types I, III, and IV (in vitro) . By cleaving and activating receptor F2RL1/PAR-2, enhances endothelial cell barrier function and thus vascular integrity during neutrophil transendothelial migration. May play a role in neutrophil transendothelial migration, probably when associated with CD177.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

72.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human TXNDC17 shRNA (UAS) - Lentiviral human TXNDC17 shRNA (UAS, iRFP) (25)
GTR15095894 1 Vial

Lentiviral human TXNDC17 shRNA (UAS) - Lentiviral human TXNDC17 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Tfe3 (NM_001271491) Mouse Tagged ORF Clone
MR229876 10 µg

Tfe3 (NM_001271491) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ASC / TMS1 Polyclonal Antibody
E-AB-60228-01 60 μL

ASC / TMS1 Polyclonal Antibody

Sign In for Pricing
View Details
ASC / TMS1 Polyclonal Antibody
E-AB-60228-02 120 μL

ASC / TMS1 Polyclonal Antibody

Sign In for Pricing
View Details
ASC / TMS1 Polyclonal Antibody
E-AB-60228-03 200 µL

ASC / TMS1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-Shigella flexneri YOAF Polyclonal Antibody
MBS7161590 Inquire

Rabbit anti-Shigella flexneri YOAF Polyclonal Antibody

Sign In for Pricing
View Details