Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rotavirus A Non-structural glycoprotein 4, partial

Product Specifications

Product Name Alternative

NCVP5 (NS28) (NSP4)

Abbreviation

Recombinant Rotavirus A Non-structural glycoprotein 4 protein, partial

UniProt

Q9PYC8

Expression Region

52-175aa

Organism

Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A)

Target Sequence

PTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMERVVKEMRRHFKMIDKLTTREIEQVGLLKRIHDKLDIRAVDEIDMTKEINQKNVRTLEEWEWGKNPYEPKEVTAAM

Tag

N-terminal 6xHis-KSI-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Plays an essential role in the virus replication cycle by acting as a viroporin. Creates a pore in the host reticulum endoplasmic and as a consequence releases Ca2+ in the cytoplasm of infected cell. In turn, high levels of cytoplasmic calcium trigger membrane trafficking and transport of viral ER-associated proteins to viroplasms, sites of viral genome replication and immature particle assembly. The secreted form acts as an enterotoxin that causes phospholipase C-dependent elevation of the intracellular calcium concentration in host intestinal mucosa cells. Increased concentration of intracellular calcium disrupts the cytoskeleton and the tight junctions, raising the paracellular permeability. Potentiates chloride ion secretion through a calcium ion-dependent signaling pathway, inducing age-dependent diarrhea. To perform this enterotoxigenic role in vivo, NSP4 is released from infected enterocytes in a soluble form capable of diffusing within the intestinal lumen and interacting with host plasma membrane receptors on neighboring epithelial cells such as integrins ITGA1/ITGB1 and ITGA2/ITGB1

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

30.1 kDa

References & Citations

"Species specificity and interspecies relatedness of NSP4 genetic groups by comparative NSP4 sequence analyses of animal rotaviruses." Ciarlet M., Liprandi F., Conner M.E., Estes M.K. Arch. Virol. 145:371-383 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-3689a-5p miRNA Agomir
orb1920393-01 5 nmol

Hsa-miR-3689a-5p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-3689a-5p miRNA Agomir
orb1920393-02 10 nmol

Hsa-miR-3689a-5p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-3689a-5p miRNA Agomir
orb1920393-03 20 nmol

Hsa-miR-3689a-5p miRNA Agomir

Sign In for Pricing
View Details
Anti-CXCR3 Antibody Picoband®
PB9079 100 µg/Vial

Anti-CXCR3 Antibody Picoband®

Sign In for Pricing
View Details
Anti-APC Nectin-1/CD111 (Rabbit, Monoclonal)
A108902 100 µL

Anti-APC Nectin-1/CD111 (Rabbit, Monoclonal)

Sign In for Pricing
View Details
Cyclopyrimorate
T15029-01 5 mg

Cyclopyrimorate

Sign In for Pricing
View Details