Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HVEM/TNFRSF14, Mouse (HEK293, hFc)

HVEM (herpes virus entry mediator, TNFRSF14, CD270) is a member of the tumor necrosis factor receptor superfamily (TNFRSF) . HVEM is a bidirectional molecular switch that transduces positive and negative signals. HVEM can deliver proinflammatory and survival signals when engaged by BTLA or LIGHT, stimulating lymphocyte proliferation, activation, and inducing inflammatory reactions. While, HVEM binds to CD160 and BTLA, inhibiting T- and B-lymphocyte activation and proliferation[2][3]. HVEM/TNFRSF14 Protein, Mouse (HEK293, Fc) is a recombinant protein with a C-Terminal Fc label, It consists of 169 amino acids (Q39-V207) and is produced in HEK293 cells.

Product Specifications

Product Name Alternative

HVEM/TNFRSF14 Protein, Mouse (HEK293, hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnfrsf14-protein-mouse-hek-293-hfc.html

Purity

96.88

Smiles

QPSCRQEEFLVGDECCPMCNPGYHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCADCLTGTFSLGGTQEECLPWTNCSAFQQEVRRGTNSTDTTCSSQV

Molecular Formula

230979 (Gene_ID) Q80WM9 (Q39-V207) (Accession)

Molecular Weight

50-65 kDa

References & Citations

[1]Ma B, et al. High expression of HVEM is associated with improved prognosis in intrahepatic cholangiocarcinoma. Oncol Lett. 2021 Jan;21 (1) :69.|[2]Yu X, et al. BTLA/HVEM Signaling: Milestones in Research and Role in Chronic Hepatitis B Virus Infection. Front Immunol. 2019 Mar 29;10:617.|[3]Rodriguez-Barbosa JI, et al. HVEM, a cosignaling molecular switch, and its interactions with BTLA, CD160 and LIGHT. Cell Mol Immunol. 2019 Jul;16 (7) :679-682.|[4]Cai G, et al. Amelioration of myocarditis by HVEM-overexpressing dendritic cells through induction of IL-10-producing cells. Cardiovasc Res. 2009 Dec 1;84 (3) :425-33.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Escherichia coli O17:K52:H18 (strain UMN026/ExPEC) RUTF Polyclonal Antibody
MBS7175686 Inquire

Rabbit anti-Escherichia coli O17:K52:H18 (strain UMN026/ExPEC) RUTF Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) SFC4 Polyclonal Antibody
MBS7182389 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) SFC4 Polyclonal Antibody

Sign In for Pricing
View Details
RN5S286 Protein Vector (Human) (pPM-C-HA)
PV116744 500 ng

RN5S286 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Bcl2l14 (NM_025778) Mouse Untagged Clone
MC201727 10 µg

Bcl2l14 (NM_025778) Mouse Untagged Clone

Sign In for Pricing
View Details
Rat Gap junction gamma-2 protein, GJC2 ELISA Kit
MBS9319152-01 48 Well

Rat Gap junction gamma-2 protein, GJC2 ELISA Kit

Sign In for Pricing
View Details
Rat Gap junction gamma-2 protein, GJC2 ELISA Kit
MBS9319152-02 96 Well

Rat Gap junction gamma-2 protein, GJC2 ELISA Kit

Sign In for Pricing
View Details