Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

4-1BB/TNFRSF9, Mouse (HEK293, Fc, solution)

4-1BB (CD137; TNFRSF9), a receptor of TNFSF9/4-1BBL, belongs to the tumor necrosis factor (TNF) receptor superfamily[1]. 4-1BB is helpful for T cell activation and development, and also induces peripheral mononuclear cell proliferation and migration to the tumor microenvironment[2]. 4-1BB is also involved in enhancing Nrf2 and NF-κB pathway mediated apoptosis of endothelial cells[3]. Mouse 4-1BB protein is a surface glycoprotein with a transmembrane domain (188-208 a.a.) . 4-1BB/TNFRSF9 Protein, Mouse (HEK293, Fc, solution) is the extracellular part (V24-L187) of 4-1BB protein, produced by HEK293 cells with C-terminal Fc-tag.

Product Specifications

Product Name Alternative

4-1BB/TNFRSF9 Protein, Mouse (HEK293, Fc, solution), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/4-1bb-tnfrsf9-protein-mouse-hek293-fc.html

Purity

96.12

Smiles

VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVL

Molecular Formula

21942 (Gene_ID) P20334 (V24-L187) (Accession)

Molecular Weight

60-70 kDa

References & Citations

[1]Dass S Vinay, et al. 4-1BB (CD137), an Inducible Costimulatory Receptor, as a Specific Target for Cancer Therapy. BMB Rep. 2014 Mar;47 (3) :122-9.|[2]Ye L, et al. CD137, an attractive candidate for the immunotherapy of lung cancer. Cancer Sci. 2020 May;111 (5) :1461-1467.|[3]Jiang P, et al. CD137 promotes bone metastasis of breast cancer by enhancing the migration and osteoclast differentiation of monocytes/macrophages. Theranostics. 2019 May 9;9 (10) :2950-2966.|[4]Geng T, et al. CD137 Signaling Promotes Endothelial Apoptosis by Inhibiting Nrf2 Pathway, and Upregulating NF-κB Pathway. Mediators Inflamm. 2020 Jun 6;2020:4321912.|[5]Pauly S, et al. CD137 is expressed by follicular dendritic cells and costimulates B lymphocyte activation in germinal centers. J Leukoc Biol. 2002 Jul;72 (1) :35-42.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BACH1 Antibody
KC-3570-01 50 μL

BACH1 Antibody

Sign In for Pricing
View Details
BACH1 Antibody
KC-3570-02 100 µL

BACH1 Antibody

Sign In for Pricing
View Details
BACH1 Antibody
KC-3570-03 1 mL

BACH1 Antibody

Sign In for Pricing
View Details
Zfp524 Mouse Gene Knockout Kit (CRISPR)
KN519869 1 Kit

Zfp524 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Bolandiol
TRC-B675000-50MG 50 mg

Bolandiol

Sign In for Pricing
View Details
USH1C Antibody
OC-054-01 50 μL

USH1C Antibody

Sign In for Pricing
View Details