Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG1A, Rat (HEK293, Fc)

REG1A Protein serves as an inhibitor of spontaneous calcium carbonate precipitation.REG1A Protein, Rat (HEK293, Fc) is the recombinant rat-derived REG1A protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

REG1A Protein, Rat (HEK293, Fc), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg1a-protein-rat-hek293-fc.html

Purity

97.00

Smiles

QEAEEDLPSARITCPEGSNAYSSYCYYFMEDHLSWAEADLFCQNMNSGYLVSVLSQAEGNFLASLIKESGTTAANVWIGLHDPKNNRRWHWSSGSLFLYKSWDTGYPNNSNRGYCVSVTSNSGYKKWRDNSCDAQLSFVCKFKA

Molecular Formula

24714 (Gene_ID) P10758 (Q22-A165) (Accession)

Molecular Weight

Approximately 43-47 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Tumor necrosis factor ligand superfamily member 15 (TNFSF15)
orb2986655-01 20 µg

Recombinant Human Tumor necrosis factor ligand superfamily member 15 (TNFSF15)

Sign In for Pricing
View Details
Recombinant Human Tumor necrosis factor ligand superfamily member 15 (TNFSF15)
orb2986655-02 100 µg

Recombinant Human Tumor necrosis factor ligand superfamily member 15 (TNFSF15)

Sign In for Pricing
View Details
Recombinant Human Tumor necrosis factor ligand superfamily member 15 (TNFSF15)
orb2986655-03 1 mg

Recombinant Human Tumor necrosis factor ligand superfamily member 15 (TNFSF15)

Sign In for Pricing
View Details
FLAP Rabbit Monoclonal Antibody [KD Validation]
E51K1653 40 µL

FLAP Rabbit Monoclonal Antibody [KD Validation]

Sign In for Pricing
View Details
IFI35 Mouse Monoclonal Antibody [Clone ID: LBI2B9]
AMM11627V 100 µL

IFI35 Mouse Monoclonal Antibody [Clone ID: LBI2B9]

Sign In for Pricing
View Details
Cd4 Rabbit Monoclonal Antibody [Clone ID: OX-38]
TA399792 0.2 mg

Cd4 Rabbit Monoclonal Antibody [Clone ID: OX-38]

Sign In for Pricing
View Details