Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tumor necrosis factor (Tnf), partial (Active)

Product Specifications

Product Name Alternative

Tumor Necrosis Factor; Cachectin; TNF-Alpha; Tumor Necrosis Factor Ligand Superfamily Member 2; TNF-a; Tumor Necrosis Factor; Membrane Form; Tumor Necrosis Factor; Soluble Form; Tnf; Tnfa; Tnfsf2

Abbreviation

Recombinant Mouse Tnf protein, partial (Active)

Gene Name

Tnf

UniProt

P06804

Expression Region

89-235aa

Organism

Mus musculus (Mouse)

Target Sequence

DKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

Tumor Necrosis Factor (TNF) is a member of the Tumor Necrosis Factor family. TNF exists as a homotrimer and interacts with SPPL2B. TNF is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. TNF is a key cytokine in the development of several inflammatory disorders. It contributes to the development of type 2 diabetes throught its effects on insulin resistance and fatty acid metabolism.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

The ED50 as determined in a cytotoxicity assay using L‑929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D is 2-8 pg/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.; FUNCTION

Molecular Weight

16.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CASK Rabbit Polyclonal Antibody
E10G09435 100 µL

CASK Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ccl2 Mouse Recombinant Protein
TP727580 10 µg

Ccl2 Mouse Recombinant Protein

Sign In for Pricing
View Details
VTCN1 Antibody
orb534961-01 20 µg

VTCN1 Antibody

Sign In for Pricing
View Details
VTCN1 Antibody
orb534961-02 100 µg

VTCN1 Antibody

Sign In for Pricing
View Details
VTCN1 Antibody
orb534961-03 100 ug (without BSA and Azide)

VTCN1 Antibody

Sign In for Pricing
View Details
NQO1 Rabbit anti-Human Polyclonal (Internal region (near N-Terminus)) Antibody
MBS2403875-01 0.05 mg

NQO1 Rabbit anti-Human Polyclonal (Internal region (near N-Terminus)) Antibody

Sign In for Pricing
View Details