Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKCE, Human (His)

PKCE proteins are calcium-independent, phospholipid- and diacylglycerol (DAG) -dependent serine/threonine protein kinases. PRKCE Protein, Human (His) is the recombinant human-derived PKCE protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PRKCE Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pkce-protein-human-his.html

Smiles

QELEYGPSVDWWALGVLMYEMMAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVASQNGEDAIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPVLTLVDEAIVKQINQEEFKGFSYFGEDLMP

Molecular Formula

5581 (Gene_ID) Q02156 (Q580-P737) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rubella IgG AccuBind ELISA Kit
6325-300B 192 Well

Rubella IgG AccuBind ELISA Kit

Sign In for Pricing
View Details
Test Tube Stand, ALU.
2072960/4G 1 Each

Test Tube Stand, ALU.

Sign In for Pricing
View Details
Porcine Interleukin Receptor Associated Kinase IRAK ELISA Kit
BG-POR11429 1 Each

Porcine Interleukin Receptor Associated Kinase IRAK ELISA Kit

Sign In for Pricing
View Details
MSRA Antibody, HRP Conjugated
MBS7114631-01 0.05 mL

MSRA Antibody, HRP Conjugated

Sign In for Pricing
View Details
MSRA Antibody, HRP Conjugated
MBS7114631-02 0.1 mL

MSRA Antibody, HRP Conjugated

Sign In for Pricing
View Details
MSRA Antibody, HRP Conjugated
MBS7114631-03 5x 0.1 mL

MSRA Antibody, HRP Conjugated

Sign In for Pricing
View Details