Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKCE, Human (His)

PKCE proteins are calcium-independent, phospholipid- and diacylglycerol (DAG) -dependent serine/threonine protein kinases. PRKCE Protein, Human (His) is the recombinant human-derived PKCE protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PRKCE Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pkce-protein-human-his.html

Smiles

QELEYGPSVDWWALGVLMYEMMAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVASQNGEDAIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPVLTLVDEAIVKQINQEEFKGFSYFGEDLMP

Molecular Formula

5581 (Gene_ID) Q02156 (Q580-P737) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUP37 Antibody / Nucleoporin 37
RQ8425 100 µg

NUP37 Antibody / Nucleoporin 37

Sign In for Pricing
View Details
CTTNBP2NL Protein Vector (Mouse) (pPM-C-His)
PV168953 500 ng

CTTNBP2NL Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Understanding The Periodic Table Game Puzzle
2069400 1 Each

Understanding The Periodic Table Game Puzzle

Sign In for Pricing
View Details
Sodium ascorbate
C10049-01 50 mg

Sodium ascorbate

Sign In for Pricing
View Details
Sodium ascorbate
C10049-02 1 g

Sodium ascorbate

Sign In for Pricing
View Details
Anti-HINT2
orb1133178 100 µL

Anti-HINT2

Sign In for Pricing
View Details