Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-4, Mouse (HEK293)

IL-4 Protein, Mouse (HEK293) is a species-specific cytokine which promotes the proliferation, differentiation and cell-surface protein modulation of B lymphocytes.

Product Specifications

Product Name Alternative

IL-4 Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-4-protein-mouse-hek293.html

Purity

96.00

Smiles

HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS

Molecular Formula

16189 (Gene_ID) P07750 (H21-S140) (Accession)

Molecular Weight

Approximately 19.2 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Imidaclothiz-d4
TRC-I275002-25MG 25 mg

Imidaclothiz-d4

Sign In for Pricing
View Details
rac FTY720-d4 Phosphate
TRC-F805012-1MG 1 mg

rac FTY720-d4 Phosphate

Sign In for Pricing
View Details
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Bovine IgG, Fc Specific,  5nm
GAF-412-5 1 mL

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Bovine IgG, Fc Specific, 5nm

Sign In for Pricing
View Details
5-Chloro-2-[(ethoxycarbonyl)oxy]-1H-indole-1-carboxylic Acid Ethyl Ester
TRC-C433028-250MG 250 mg

5-Chloro-2-[(ethoxycarbonyl)oxy]-1H-indole-1-carboxylic Acid Ethyl Ester

Sign In for Pricing
View Details
Cytokeratin 17 (KRT17/778), CF405S conjugate, 0.1mg/mL
BNC040778-500 1x 500 µL

Cytokeratin 17 (KRT17/778), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (IGEL/773), 0.2mg/mL
BNUB0773-100 1x 100 µL

CD20 (IGEL/773), 0.2mg/mL

Sign In for Pricing
View Details