Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-4, Mouse (HEK293)

IL-4 Protein, Mouse (HEK293) is a species-specific cytokine which promotes the proliferation, differentiation and cell-surface protein modulation of B lymphocytes.

Product Specifications

Product Name Alternative

IL-4 Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-4-protein-mouse-hek293.html

Purity

96.00

Smiles

HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS

Molecular Formula

16189 (Gene_ID) P07750 (H21-S140) (Accession)

Molecular Weight

Approximately 19.2 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDGF Receptor alpha (PDGFRA) Mouse Monoclonal Antibody [Clone ID: 16A1]
AM12068AC-N 100 Tests

PDGF Receptor alpha (PDGFRA) Mouse Monoclonal Antibody [Clone ID: 16A1]

Sign In for Pricing
View Details
EAAT1 Recombinant Rabbit Monoclonal Antibody [JA30-35]
ET1704-54 100 µL

EAAT1 Recombinant Rabbit Monoclonal Antibody [JA30-35]

Sign In for Pricing
View Details
INDOL1 (IDO2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6G3]
TA806161AM 100 µL

INDOL1 (IDO2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6G3]

Sign In for Pricing
View Details
DDC Polyclonal Antibody
E-AB-19409-01 20 µL

DDC Polyclonal Antibody

Sign In for Pricing
View Details
DDC Polyclonal Antibody
E-AB-19409-02 60 µL

DDC Polyclonal Antibody

Sign In for Pricing
View Details
DDC Polyclonal Antibody
E-AB-19409-03 120 µL

DDC Polyclonal Antibody

Sign In for Pricing
View Details