Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-4, Mouse (HEK293)

IL-4 Protein, Mouse (HEK293) is a species-specific cytokine which promotes the proliferation, differentiation and cell-surface protein modulation of B lymphocytes.

Product Specifications

Product Name Alternative

IL-4 Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-4-protein-mouse-hek293.html

Purity

96.00

Smiles

HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS

Molecular Formula

16189 (Gene_ID) P07750 (H21-S140) (Accession)

Molecular Weight

Approximately 19.2 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human EGF (Epidermal Growth Factor) ELISA Kit
E-EL-H0059-01 24 Tests

Human EGF (Epidermal Growth Factor) ELISA Kit

Sign In for Pricing
View Details
Human EGF (Epidermal Growth Factor) ELISA Kit
E-EL-H0059-02 48 Tests

Human EGF (Epidermal Growth Factor) ELISA Kit

Sign In for Pricing
View Details
Human EGF (Epidermal Growth Factor) ELISA Kit
E-EL-H0059-03 96 Tests

Human EGF (Epidermal Growth Factor) ELISA Kit

Sign In for Pricing
View Details
SFMBT1 (NM_001005159) Human Over-expression Lysate
LY423946 100 µg

SFMBT1 (NM_001005159) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Fadd Antibody
RC-4896-01 50 μL

Recombinant Fadd Antibody

Sign In for Pricing
View Details
Recombinant Fadd Antibody
RC-4896-02 100 µL

Recombinant Fadd Antibody

Sign In for Pricing
View Details