Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-4, Mouse (HEK293)

IL-4 Protein, Mouse (HEK293) is a species-specific cytokine which promotes the proliferation, differentiation and cell-surface protein modulation of B lymphocytes.

Product Specifications

Product Name Alternative

IL-4 Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-4-protein-mouse-hek293.html

Purity

96.00

Smiles

HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS

Molecular Formula

16189 (Gene_ID) P07750 (H21-S140) (Accession)

Molecular Weight

Approximately 19.2 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR6829 Human qPCR Template Standard (MI0022674)
HK301430 200 Reactions

MIR6829 Human qPCR Template Standard (MI0022674)

Sign In for Pricing
View Details
Anti-NBR1  (2E7)
YF-MA14036 100 ug

Anti-NBR1 (2E7)

Sign In for Pricing
View Details
ACP6 Antibody, HRP conjugated
CSB-PA889072LB01HU-01 50 µg

ACP6 Antibody, HRP conjugated

Sign In for Pricing
View Details
ACP6 Antibody, HRP conjugated
CSB-PA889072LB01HU-02 100 µg

ACP6 Antibody, HRP conjugated

Sign In for Pricing
View Details
Lentiviral mouse Mycbpap shRNA (UAS) - Lentiviral mouse Mycbpap shRNA (UAS) (100)
GTR15175878 1 Vial

Lentiviral mouse Mycbpap shRNA (UAS) - Lentiviral mouse Mycbpap shRNA (UAS) (100)

Sign In for Pricing
View Details
Recombinant Moorella thermoacetica Probable tRNA sulfurtransferase (thiI)
MBS1406965-01 0.02 mg (E-Coli)

Recombinant Moorella thermoacetica Probable tRNA sulfurtransferase (thiI)

Sign In for Pricing
View Details