Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFF3, Human

TFF-3 Protein, Human is a regulatory peptide involved in mucosal protection and repair in the gastrointestinal tract.

Product Specifications

Product Name Alternative

TFF3 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/tff-3-protein-human.html

Purity

97.52

Smiles

EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF

Molecular Formula

7033 (Gene_ID) Q07654 (E22-F80) (Accession)

Molecular Weight

Approximately 6.6 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Zhang BH, et al. The therapeutic effect of recombinant human trefoil factor 3 on hypoxia-induced necrotizing enterocolitis in immature rat. Regul Pept. 2003 Nov 15;116 (1-3) :53-60.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TLN1 (Talin 1, ILWEQ, KIAA1027, TLN) (AP) discontinued
252709-AP 100 µL

TLN1 (Talin 1, ILWEQ, KIAA1027, TLN) (AP) discontinued

Sign In for Pricing
View Details
CHOP Antibody [K6F19]
C15174-100uL 100 µL

CHOP Antibody [K6F19]

Sign In for Pricing
View Details
Ocaratuzumab ELISA Kit
DY257078 96 Tests

Ocaratuzumab ELISA Kit

Sign In for Pricing
View Details
RpS3A Antibody
orb807329 2 mg

RpS3A Antibody

Sign In for Pricing
View Details
Rno-miR-490-5p miRNA Inhibitor
orb1868467-01 10 nmol

Rno-miR-490-5p miRNA Inhibitor

Sign In for Pricing
View Details
Rno-miR-490-5p miRNA Inhibitor
orb1868467-02 20 nmol

Rno-miR-490-5p miRNA Inhibitor

Sign In for Pricing
View Details