Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UCHL3, Rat (His)

The UCHL3 protein is a deubiquitinating enzyme (DUB) that complexly controls cellular ubiquitin levels by processing ubiquitin precursors and ubiquitinated proteins. As a thiol protease, UCHL3 selectively recognizes and hydrolyzes the peptide bond of ubiquitin or the C-terminal glycine of NEDD8, showing a 10-fold preference for Arg and Lys at the P3 position, and has a special preference for "Lys-48" linked ubiquitin chains. affinity. UCHL3 Protein, Rat (His) is the recombinant rat-derived UCHL3 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

UCHL3 Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/uch-l3-protein-rat-his.html

Purity

98.0

Smiles

EGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMEPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSALKKFLEESVAMSPEERARHLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGKTSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA

Molecular Formula

498560 (Gene_ID) Q91Y78 (E2-A230) (Accession)

Molecular Weight

Approximately 28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

DOT1L Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6E7]
TA802738BM 100 µL

DOT1L Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6E7]

Ask
View Details
Recombinant Human Talin-2 Protein, His, Yeast-1mg
QP8291-ye-1mg 1mg

Recombinant Human Talin-2 Protein, His, Yeast-1mg

Ask
View Details
ERP44, 30-406aa, Human, His tag, E.coli
E53A02047 50 µg

ERP44, 30-406aa, Human, His tag, E.coli

Ask
View Details
Asialoglycoprotein Receptor 2 (ASGR2) (NM_001181) Human Tagged Lenti ORF Clone
RC213607L1 10 µg

Asialoglycoprotein Receptor 2 (ASGR2) (NM_001181) Human Tagged Lenti ORF Clone

Ask
View Details
Lentiviral human SMIM18 sgRNA gene knockout kit - Lentiviral human SMIM18 sgRNA gene knockout kit (25)
GTR15357900 1 Vial

Lentiviral human SMIM18 sgRNA gene knockout kit - Lentiviral human SMIM18 sgRNA gene knockout kit (25)

Ask
View Details
HT® Lenti-CDK4 Immortalization Kit
CIK-HT022 1 Kit

HT® Lenti-CDK4 Immortalization Kit

Ask
View Details