Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UCHL3, Rat (His)

The UCHL3 protein is a deubiquitinating enzyme (DUB) that complexly controls cellular ubiquitin levels by processing ubiquitin precursors and ubiquitinated proteins. As a thiol protease, UCHL3 selectively recognizes and hydrolyzes the peptide bond of ubiquitin or the C-terminal glycine of NEDD8, showing a 10-fold preference for Arg and Lys at the P3 position, and has a special preference for "Lys-48" linked ubiquitin chains. affinity. UCHL3 Protein, Rat (His) is the recombinant rat-derived UCHL3 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

UCHL3 Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/uch-l3-protein-rat-his.html

Purity

98.0

Smiles

EGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMEPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSALKKFLEESVAMSPEERARHLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGKTSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA

Molecular Formula

498560 (Gene_ID) Q91Y78 (E2-A230) (Accession)

Molecular Weight

Approximately 28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

S100a6 (NM_053485) Rat Tagged Lenti ORF Clone
RR208795L3 10 µg

S100a6 (NM_053485) Rat Tagged Lenti ORF Clone

Ask
View Details
ZNF146 (NM_007145) Human Tagged Lenti ORF Clone
RC222413L4 10 µg

ZNF146 (NM_007145) Human Tagged Lenti ORF Clone

Ask
View Details
Mouse Monoclonal GSTA4 Antibody (OTI3F5) - Azide and BSA Free
NBP2-70856 100 µg

Mouse Monoclonal GSTA4 Antibody (OTI3F5) - Azide and BSA Free

Ask
View Details
Epithelial Cell Surface Antigen (ESA, Adenocarcinoma-associated Antigen, CD326, CD326 Antigen, Cell Surface Glycoprotein Trop1, Cell Surface Glycoprotein Trop-1, CO-17A, CO17-1A, Epithelial Cellular Adhesion Molecule, Ep CAM, EpCAM, Ep-CAM, Epithelial Glycoprotein, EGP, EGP40, GA733-2, hEGP-2, KS-1/4 Antigen, KSA, M1S2, M4S1, Major Gastrointestinal Tumor Associated Protein GA733-2, MIC18, MK-1, Tumor-associated Calcium Signal Transducer 1, TACD1, TACSTD1, TROP1) (Biotin)
E3405-50-Biotin 100 µL

Epithelial Cell Surface Antigen (ESA, Adenocarcinoma-associated Antigen, CD326, CD326 Antigen, Cell Surface Glycoprotein Trop1, Cell Surface Glycoprotein Trop-1, CO-17A, CO17-1A, Epithelial Cellular Adhesion Molecule, Ep CAM, EpCAM, Ep-CAM, Epithelial Glycoprotein, EGP, EGP40, GA733-2, hEGP-2, KS-1/4 Antigen, KSA, M1S2, M4S1, Major Gastrointestinal Tumor Associated Protein GA733-2, MIC18, MK-1, Tumor-associated Calcium Signal Transducer 1, TACD1, TACSTD1, TROP1) (Biotin)

Ask
View Details