Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UCHL3, Rat (His)

The UCHL3 protein is a deubiquitinating enzyme (DUB) that complexly controls cellular ubiquitin levels by processing ubiquitin precursors and ubiquitinated proteins. As a thiol protease, UCHL3 selectively recognizes and hydrolyzes the peptide bond of ubiquitin or the C-terminal glycine of NEDD8, showing a 10-fold preference for Arg and Lys at the P3 position, and has a special preference for "Lys-48" linked ubiquitin chains. affinity. UCHL3 Protein, Rat (His) is the recombinant rat-derived UCHL3 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

UCHL3 Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/uch-l3-protein-rat-his.html

Purity

98.0

Smiles

EGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMEPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSALKKFLEESVAMSPEERARHLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGKTSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA

Molecular Formula

498560 (Gene_ID) Q91Y78 (E2-A230) (Accession)

Molecular Weight

Approximately 28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TREM1 (Triggering Receptor Expressed on Myeloid Cells 1, TREM-1, Triggering Receptor Expressed on Monocytes 1, CD354) (MaxLight 550)
MBS6214520-01 0.1 mL

TREM1 (Triggering Receptor Expressed on Myeloid Cells 1, TREM-1, Triggering Receptor Expressed on Monocytes 1, CD354) (MaxLight 550)

Ask
View Details
TREM1 (Triggering Receptor Expressed on Myeloid Cells 1, TREM-1, Triggering Receptor Expressed on Monocytes 1, CD354) (MaxLight 550)
MBS6214520-02 5x 0.1 mL

TREM1 (Triggering Receptor Expressed on Myeloid Cells 1, TREM-1, Triggering Receptor Expressed on Monocytes 1, CD354) (MaxLight 550)

Ask
View Details
Rabbit anti-SLX4IP/C20orf94 Antibody, Affinity Purified
A304-995A-T 10 µg

Rabbit anti-SLX4IP/C20orf94 Antibody, Affinity Purified

Ask
View Details
TIMP2 Biotinylated Mouse Monoclonal Detection Antibody (Biotin conjugated) [Clone ID: OTI2G7]
TA700235 50 µg

TIMP2 Biotinylated Mouse Monoclonal Detection Antibody (Biotin conjugated) [Clone ID: OTI2G7]

Ask
View Details
Syntaxin 4 Rabbit Monoclonal Antibody
E49Y8268 100 µL

Syntaxin 4 Rabbit Monoclonal Antibody

Ask
View Details
FN1 Polyclonal Antibody
ABP51356-01 30 µL

FN1 Polyclonal Antibody

Ask
View Details