Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UCHL3, Rat (His)

The UCHL3 protein is a deubiquitinating enzyme (DUB) that complexly controls cellular ubiquitin levels by processing ubiquitin precursors and ubiquitinated proteins. As a thiol protease, UCHL3 selectively recognizes and hydrolyzes the peptide bond of ubiquitin or the C-terminal glycine of NEDD8, showing a 10-fold preference for Arg and Lys at the P3 position, and has a special preference for "Lys-48" linked ubiquitin chains. affinity. UCHL3 Protein, Rat (His) is the recombinant rat-derived UCHL3 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

UCHL3 Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/uch-l3-protein-rat-his.html

Purity

98.0

Smiles

EGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMEPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSALKKFLEESVAMSPEERARHLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGKTSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA

Molecular Formula

498560 (Gene_ID) Q91Y78 (E2-A230) (Accession)

Molecular Weight

Approximately 28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PITPNM1, NT (PITPNM1, DRES9, NIR2, PITPNM, Membrane-associated phosphatidylinositol transfer protein 1, Drosophila retinal degeneration B homolog, Phosphatidylinositol transfer protein, membrane-associated 1, Pyk2 N-terminal domain-interacting receptor 2) (AP) discontinued
040083-AP 200 µL

PITPNM1, NT (PITPNM1, DRES9, NIR2, PITPNM, Membrane-associated phosphatidylinositol transfer protein 1, Drosophila retinal degeneration B homolog, Phosphatidylinositol transfer protein, membrane-associated 1, Pyk2 N-terminal domain-interacting receptor 2) (AP) discontinued

Ask
View Details