Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human papillomavirus 11 Protein E7 (E7)

Product Specifications

Abbreviation

Recombinant Human papillomavirus 11 E7 protein

Gene Name

E7

UniProt

P04020

Expression Region

1-98aa

Organism

Human papillomavirus 11

Target Sequence

MHGRLVTLKDIVLDLQPPDPVGLHCYEQLEDSSEDEVDKVDKQDAQPLTQHYQILTCCCGCDSNVRLVVECTDGDIRQLQDLLLGTLNIVCPICAPKP

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dabigatran Ethyl Ester Hydrochloride Salt
TRC-D100135-25MG 25 mg

Dabigatran Ethyl Ester Hydrochloride Salt

Sign In for Pricing
View Details
HSP70-1A (HSPA1A) Mouse Monoclonal Antibody [Clone ID: 4E7]
AM09017PU-S 50 µL

HSP70-1A (HSPA1A) Mouse Monoclonal Antibody [Clone ID: 4E7]

Sign In for Pricing
View Details
Phospho-FAK (Y397) Recombinant Rabbit Monoclonal Antibody [SC54-07]
ET1610-34 100 µL

Phospho-FAK (Y397) Recombinant Rabbit Monoclonal Antibody [SC54-07]

Sign In for Pricing
View Details
13-cis-Retinal 95%
TRC-R239900-5MG 5 mg

13-cis-Retinal 95%

Sign In for Pricing
View Details
HER-4 / ERBB4 (ERBB4/2581), 0.2mg/mL
BNUB2581-500 1x 500 µL

HER-4 / ERBB4 (ERBB4/2581), 0.2mg/mL

Sign In for Pricing
View Details
IL3RA / CD123 (Acute Myeloid Leukemia Marker) (IL3RA/1531), CF740 conjugate, 0.1mg/mL
BNC741531-500 1x 500 µL

IL3RA / CD123 (Acute Myeloid Leukemia Marker) (IL3RA/1531), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details