RANTES/CCL5, Mouse (HEK293, Fc)

RANTES/CCL5 Protein, Mouse (HEK293, Fc) is a key pro-inflammatory chemokine in the CC chemokine family that interacts with CCR1, CCR3, CCR4, and CCR5 to mediate inflammatory immune responses, viral infections, and tumorigenesis.RANTES/CCL5 Protein, Mouse (HEK293, Fc) is a recombinant mouse RANTES/CCL5 (S24-S91) protein expressed by HEK293 with a hFc tag at the N-terminu[1].

Product Specifications

Product Name Alternative

RANTES/CCL5 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rantes-ccl5-protein-mouse-hek293-fc.html

Purity

95.00

Smiles

SPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS

Molecular Formula

20304 (Gene_ID) P30882 (S24-S91) (Accession)

Molecular Weight

40-45 kDa

References & Citations

[1]V Appay, et al. RANTES: a versatile and controversial chemokine. Trends Immunol. 2001 Feb;22 (2) :83-7.|[2]Zhen Zeng, et al. CCL5/CCR5 axis in human diseases and related treatments. Genes Dis. 2022 Jan;9 (1) :12-27.|[3]F Cocchi, et al. Identification of RANTES, MIP-1 alpha, and MIP-1 beta as the major HIV-suppressive factors produced by CD8+ T cells. Science. 1995 Dec 15;270 (5243) :1811-5.|[4]Sara González-Rodríguez, et al. Hyperalgesic and hypoalgesic mechanisms evoked by the acute administration of CCL5 in mice. Brain Behav Immun. 2017 May;62:151-161.