Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANTES/CCL5, Mouse (HEK293, Fc)

RANTES/CCL5 Protein, Mouse (HEK293, Fc) is a key pro-inflammatory chemokine in the CC chemokine family that interacts with CCR1, CCR3, CCR4, and CCR5 to mediate inflammatory immune responses, viral infections, and tumorigenesis.RANTES/CCL5 Protein, Mouse (HEK293, Fc) is a recombinant mouse RANTES/CCL5 (S24-S91) protein expressed by HEK293 with a hFc tag at the N-terminu[1].

Product Specifications

Product Name Alternative

RANTES/CCL5 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rantes-ccl5-protein-mouse-hek293-fc.html

Purity

95.00

Smiles

SPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS

Molecular Formula

20304 (Gene_ID) P30882 (S24-S91) (Accession)

Molecular Weight

40-45 kDa

References & Citations

[1]V Appay, et al. RANTES: a versatile and controversial chemokine. Trends Immunol. 2001 Feb;22 (2) :83-7.|[2]Zhen Zeng, et al. CCL5/CCR5 axis in human diseases and related treatments. Genes Dis. 2022 Jan;9 (1) :12-27.|[3]F Cocchi, et al. Identification of RANTES, MIP-1 alpha, and MIP-1 beta as the major HIV-suppressive factors produced by CD8+ T cells. Science. 1995 Dec 15;270 (5243) :1811-5.|[4]Sara González-Rodríguez, et al. Hyperalgesic and hypoalgesic mechanisms evoked by the acute administration of CCL5 in mice. Brain Behav Immun. 2017 May;62:151-161.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human JAK3 Pre-designed siRNA Set A
SI007895A 1 Each

Human JAK3 Pre-designed siRNA Set A

Sign In for Pricing
View Details
CD146 (MCAM) Mouse Monoclonal Antibody [Clone ID: OTI2G10]
TA803398S 30 µL

CD146 (MCAM) Mouse Monoclonal Antibody [Clone ID: OTI2G10]

Sign In for Pricing
View Details
EIF2A (Eukaryotic Initiation Factor 2, CDA02, EIF-2A, MST089, MSTP004, MSTP089) discontinued
210631-01 50 µL

EIF2A (Eukaryotic Initiation Factor 2, CDA02, EIF-2A, MST089, MSTP004, MSTP089) discontinued

Sign In for Pricing
View Details
EIF2A (Eukaryotic Initiation Factor 2, CDA02, EIF-2A, MST089, MSTP004, MSTP089) discontinued
210631-02 100 µL

EIF2A (Eukaryotic Initiation Factor 2, CDA02, EIF-2A, MST089, MSTP004, MSTP089) discontinued

Sign In for Pricing
View Details
EIF2A (Eukaryotic Initiation Factor 2, CDA02, EIF-2A, MST089, MSTP004, MSTP089) discontinued
210631-03 200 µL

EIF2A (Eukaryotic Initiation Factor 2, CDA02, EIF-2A, MST089, MSTP004, MSTP089) discontinued

Sign In for Pricing
View Details
Human Melanoma metastasis surface adhesion molecule (MMSAM) ELISA Kit
NSL0451Hu 96 Tests

Human Melanoma metastasis surface adhesion molecule (MMSAM) ELISA Kit

Sign In for Pricing
View Details