Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANTES/CCL5, Mouse (HEK293, Fc)

RANTES/CCL5 Protein, Mouse (HEK293, Fc) is a key pro-inflammatory chemokine in the CC chemokine family that interacts with CCR1, CCR3, CCR4, and CCR5 to mediate inflammatory immune responses, viral infections, and tumorigenesis.RANTES/CCL5 Protein, Mouse (HEK293, Fc) is a recombinant mouse RANTES/CCL5 (S24-S91) protein expressed by HEK293 with a hFc tag at the N-terminu[1].

Product Specifications

Product Name Alternative

RANTES/CCL5 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rantes-ccl5-protein-mouse-hek293-fc.html

Purity

95.00

Smiles

SPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS

Molecular Formula

20304 (Gene_ID) P30882 (S24-S91) (Accession)

Molecular Weight

40-45 kDa

References & Citations

[1]V Appay, et al. RANTES: a versatile and controversial chemokine. Trends Immunol. 2001 Feb;22 (2) :83-7.|[2]Zhen Zeng, et al. CCL5/CCR5 axis in human diseases and related treatments. Genes Dis. 2022 Jan;9 (1) :12-27.|[3]F Cocchi, et al. Identification of RANTES, MIP-1 alpha, and MIP-1 beta as the major HIV-suppressive factors produced by CD8+ T cells. Science. 1995 Dec 15;270 (5243) :1811-5.|[4]Sara González-Rodríguez, et al. Hyperalgesic and hypoalgesic mechanisms evoked by the acute administration of CCL5 in mice. Brain Behav Immun. 2017 May;62:151-161.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD69 Polyclonal Antibody
PHG11601 100 μg

Anti-CD69 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal CPS1 Antibody (CPS1/8416) [DyLight 550]
NBP3-21108R 0.1 mL

Mouse Monoclonal CPS1 Antibody (CPS1/8416) [DyLight 550]

Sign In for Pricing
View Details
Pin1 rabbit pAb
ES6595-01 50 µL

Pin1 rabbit pAb

Sign In for Pricing
View Details
Pin1 rabbit pAb
ES6595-02 100 µL

Pin1 rabbit pAb

Sign In for Pricing
View Details
Rabbit anti-human AKT-interacting protein polyclonal Antibody, Biotin conjugated
MBS968755-01 0.05 mg

Rabbit anti-human AKT-interacting protein polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti-human AKT-interacting protein polyclonal Antibody, Biotin conjugated
MBS968755-02 0.1 mg

Rabbit anti-human AKT-interacting protein polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details