Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD27/TNFRSF7, Mouse (HEK293, His-Fc)

CD27/NFRSF7 Protein acts as a receptor for CD70/CD27L, supporting activated T-cell survival and potentially influencing apoptosis through interactions with SIVA1.It forms homodimers and engages with SIVA1 and TRAF2, indicating diverse roles in cellular processes.CD27/TNFRSF7 Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived CD27/TNFRSF7 protein, expressed by HEK293 , with C-hFc, C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD27/TNFRSF7 Protein, Mouse (HEK293, His-Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd27-tnfrsf7-protein-mouse-hek-293-c-fhis.html

Purity

95.0

Smiles

PNSCPDKHYWTGGGLCCRMCEPGTFFVKDCEQDRTAAQCDPCIPGTSFSPDYHTRPHCESCRHCNSGFLIRNCTVTANAECSCSKNWQCRDQECTECDPPLNPALTRQPSETPSPQPPPTHLPHGTEKPSWPLHRQLPNSTVYSQRSSHRPLCSSDCIR

Molecular Formula

21940 (Gene_ID) P41272 (P24-R182) (Accession)

Molecular Weight

60-66 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kcnj15 (NM_001039057) Mouse Tagged ORF Clone
MR224600 10 µg

Kcnj15 (NM_001039057) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
KRT38 Antibody - middle region (ARP68484_P050)
ARP68484_P050 100 µL

KRT38 Antibody - middle region (ARP68484_P050)

Sign In for Pricing
View Details
Lentiviral human NUMB shRNA (UAS) - Lentiviral human NUMB shRNA (UAS, iRFP) (25)
GTR15322385 1 Vial

Lentiviral human NUMB shRNA (UAS) - Lentiviral human NUMB shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
ITGB1 Antibody
A26055-50UG 50 µg

ITGB1 Antibody

Sign In for Pricing
View Details
G0S2 Protein Vector (Human) (pPM-C-HA)
21118021 500 ng

G0S2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Serp2 Pre-designed siRNA Set B
SI112726B 1 Each

Mouse Serp2 Pre-designed siRNA Set B

Sign In for Pricing
View Details