Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Jacalin-type lectin domain-containing protein, partial

Product Specifications

Abbreviation

Recombinant Cynomolgus monkey Jacalin-type lectin domain-containing protein, partial

UniProt

G7Q0A1

Expression Region

23-169aa

Organism

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Target Sequence

GKMYGPGGGKYFTTTEDYDHEITGLRVSVGLLLVKSVQVKLGDTWDVKQGASGGNTQEVTLQPGEYITKVFVAFQTFLRGMVLYTSKDRTFYFGKLDGQIFSVYPSQEGQVLVGIYGQYGLLGIKSIGFEWNYPLEEPTTEPPVTVT

Tag

C-terminal 10xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Cancer

Relevance

May play an important role in the pathogenesis of pancreatic cancer.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E cadherin Polyclonal Antibody, Cy5.5 Conjugated
bs-1519R-Cy5.5 100 µL

E cadherin Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Recombinant Clostridium Botulinum minE Protein (aa 1-87)
VAng-Lsx8334-1mgEcoli 1 mg (E. coli)

Recombinant Clostridium Botulinum minE Protein (aa 1-87)

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis ESX-4 secretion system protein EccC4 (eccC4), partial
MBS1171248-01 1 mg (E-Coli)

Recombinant Mycobacterium tuberculosis ESX-4 secretion system protein EccC4 (eccC4), partial

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis ESX-4 secretion system protein EccC4 (eccC4), partial
MBS1171248-02 1 mg (Yeast)

Recombinant Mycobacterium tuberculosis ESX-4 secretion system protein EccC4 (eccC4), partial

Sign In for Pricing
View Details
Human hsa-miR-759 miRNA Agomir
abx880872-01 5 nmol

Human hsa-miR-759 miRNA Agomir

Sign In for Pricing
View Details
Human hsa-miR-759 miRNA Agomir
abx880872-02 10 nmol

Human hsa-miR-759 miRNA Agomir

Sign In for Pricing
View Details