Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFPI2, Mouse (HEK293, His)

TFPI2 (tissue factor pathway inhibitor 2) is a key regulator of matrix remodeling and has inhibitory control effects on trypsin, plasmin and factor VIIa/tissue factor.It has a weak effect on factor Xa and has no effect on thrombin.Its complex interactions extend to the formation of molecular complexes with ABCB1 and PPP2R3C, resulting in dephosphorylation of ABCB1.TFPI2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TFPI2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TFPI2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tfpi2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

LTSVSAQGNNLEICLLPLDAGPCQALIPKFYYDRDQQKCRRFNYGGCLGNANNFHSRDLCQQTCGSIEKVPPVCRSELKTYPCDKPNIRFFFNLNTMTCEPLRPGLCSRTINVFSEEATCKGLCEPRKHIPSFCSSPKDEGLCSANVTRFYFNSRNKTCETFTYTGCGGNENNFYYLDACHRACVKGWKKPKRWKIGDFLPRFWKHLS

Molecular Formula

21789 (Gene_ID) O35536 (L23-S230) (Accession)

Molecular Weight

35-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (T-Cell Marker) (C3e/1931), CF405S conjugate, 0.1mg/mL
BNC041931-100 1x 100 µL

CD3e (T-Cell Marker) (C3e/1931), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (HSPB1) Mouse Monoclonal Antibody [Clone ID: OTI8C7]
CF813404 100 µg

HSP27 (HSPB1) Mouse Monoclonal Antibody [Clone ID: OTI8C7]

Sign In for Pricing
View Details
GP2 (Glycoprotein 2) / ZAP75 (GP2/3134R), CF647 conjugate, 0.1mg/mL
BNC473134-500 1x 500 µL

GP2 (Glycoprotein 2) / ZAP75 (GP2/3134R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ARHGAP12 Human Gene Knockout Kit (CRISPR)
KN415343 1 Kit

ARHGAP12 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Bcl-X (Apoptosis Marker) (BCL2L1/1762), CF488A conjugate, 0.1mg/mL
BNC881762-100 1x 100 µL

Bcl-X (Apoptosis Marker) (BCL2L1/1762), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human SLC24A4 activation kit by CRISPRa
GA114798 1 Kit

Human SLC24A4 activation kit by CRISPRa

Sign In for Pricing
View Details