Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFPI2, Mouse (HEK293, His)

TFPI2 (tissue factor pathway inhibitor 2) is a key regulator of matrix remodeling and has inhibitory control effects on trypsin, plasmin and factor VIIa/tissue factor.It has a weak effect on factor Xa and has no effect on thrombin.Its complex interactions extend to the formation of molecular complexes with ABCB1 and PPP2R3C, resulting in dephosphorylation of ABCB1.TFPI2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TFPI2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TFPI2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tfpi2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

LTSVSAQGNNLEICLLPLDAGPCQALIPKFYYDRDQQKCRRFNYGGCLGNANNFHSRDLCQQTCGSIEKVPPVCRSELKTYPCDKPNIRFFFNLNTMTCEPLRPGLCSRTINVFSEEATCKGLCEPRKHIPSFCSSPKDEGLCSANVTRFYFNSRNKTCETFTYTGCGGNENNFYYLDACHRACVKGWKKPKRWKIGDFLPRFWKHLS

Molecular Formula

21789 (Gene_ID) O35536 (L23-S230) (Accession)

Molecular Weight

35-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRITC Conjugated Goat Affinity Purified Antibody to Human Kappa (Free & Bound)
RAF-007-2 2 mL

TRITC Conjugated Goat Affinity Purified Antibody to Human Kappa (Free & Bound)

Sign In for Pricing
View Details
DNA PKcs (PRKDC) Rabbit Monoclonal Antibody
TA422583 100 µL

DNA PKcs (PRKDC) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
C1ORF95 (STUM) (NM_001003665) Human Over-expression Lysate
LY424093 100 µg

C1ORF95 (STUM) (NM_001003665) Human Over-expression Lysate

Sign In for Pricing
View Details
GRAF Recombinant Rabbit Monoclonal Antibody [JE62-23]
HA722409 100 µL

GRAF Recombinant Rabbit Monoclonal Antibody [JE62-23]

Sign In for Pricing
View Details
Tex45 Mouse Gene Knockout Kit (CRISPR)
KN500102 1 Kit

Tex45 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
THRAP3 Rabbit Polyclonal Antibody
TA382510 100 µL

THRAP3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details