GMP LR3 IGF-I/IGF-1, Human (83a.a, E51R)
The LR3 IGF-I/IGF-1 protein is similar to insulin and has potent growth-promoting activity that exceeds the efficacy of insulin. As a potential physiological regulator, it stimulates glucose transport and glycogen synthesis in osteoblasts even at significantly lower concentrations than insulin. GMP LR3 IGF-I/IGF-1 Protein, Human (83a.a, E51R) is the recombinant human-derived LR3 IGF-I/IGF-1 protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
GMP LR3 IGF-I/IGF-1 Protein, Human (83a.a, E51R), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/gmp-igf-i-igf-1-protein-human-e51r.html
Purity
98.0
Smiles
MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Molecular Formula
3479 (Gene_ID) P05019-1 (G49-A118, E51R, with a 13 amino acid extension peptide at the N terminal) (Accession)
Molecular Weight
Approximately 11 KDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
P27 / KIP1 (SX53G8), CF647 conjugate, 0.1mg/mL
CD106 / VCAM1 (1.4C3), CF594 conjugate, 0.1mg/mL
Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2603), CF594 conjugate, 0.1mg/mL
