Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GMP LR3 IGF-I/IGF-1, Human (83a.a, E51R)

The LR3 IGF-I/IGF-1 protein is similar to insulin and has potent growth-promoting activity that exceeds the efficacy of insulin. As a potential physiological regulator, it stimulates glucose transport and glycogen synthesis in osteoblasts even at significantly lower concentrations than insulin. GMP LR3 IGF-I/IGF-1 Protein, Human (83a.a, E51R) is the recombinant human-derived LR3 IGF-I/IGF-1 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

GMP LR3 IGF-I/IGF-1 Protein, Human (83a.a, E51R), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gmp-igf-i-igf-1-protein-human-e51r.html

Purity

98.0

Smiles

MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Molecular Formula

3479 (Gene_ID) P05019-1 (G49-A118, E51R, with a 13 amino acid extension peptide at the N terminal) (Accession)

Molecular Weight

Approximately 11 KDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF3 (Isoform 2) Antibody
abx432130 200 µL

RNF3 (Isoform 2) Antibody

Sign In for Pricing
View Details
Cefcapene Pivoxil Impurity 41
RM-C031641-01 10 mg

Cefcapene Pivoxil Impurity 41

Sign In for Pricing
View Details
Cefcapene Pivoxil Impurity 41
RM-C031641-02 25 mg

Cefcapene Pivoxil Impurity 41

Sign In for Pricing
View Details
Cefcapene Pivoxil Impurity 41
RM-C031641-03 50 mg

Cefcapene Pivoxil Impurity 41

Sign In for Pricing
View Details
Cefcapene Pivoxil Impurity 41
RM-C031641-04 100 mg

Cefcapene Pivoxil Impurity 41

Sign In for Pricing
View Details
Chicken Complement Component 2 ELISA kit
GTR10437060 96 Well

Chicken Complement Component 2 ELISA kit

Sign In for Pricing
View Details