Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPIH, Human (His)

The PPIH protein is a peptidyl prolyl cis-trans isomerase (PPIase) that catalyzes the isomerization of prolyl imide peptide bonds and may contribute to protein folding. It plays a crucial role in pre-mRNA splicing and contributes to the formation of the U4/U5/U6 tri-snRNP complex in spliceosome assembly. PPIH Protein, Human (His) is the recombinant human-derived PPIH protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

PPIH Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ppih-protein-human-his.html

Purity

95.66

Smiles

MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM

Molecular Formula

10465 (Gene_ID) O43447-1 (M1-M177) (Accession)

Molecular Weight

Approximately 24.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Hydroxy-4-aminobiphenyl
TRC-H767500-5MG 5 mg

N-Hydroxy-4-aminobiphenyl

Sign In for Pricing
View Details
TMEM229A (Center) Rabbit Polyclonal Antibody
AP54194PU-N 400 µL

TMEM229A (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GBP6 Antibody
KC-1656-01 50 μL

GBP6 Antibody

Sign In for Pricing
View Details
GBP6 Antibody
KC-1656-02 100 µL

GBP6 Antibody

Sign In for Pricing
View Details
GBP6 Antibody
KC-1656-03 1 mL

GBP6 Antibody

Sign In for Pricing
View Details
MSI2 Recombinant Rabbit monoclonal Antibody
HA750693 100 µL

MSI2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details