Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPIH, Human (His)

The PPIH protein is a peptidyl prolyl cis-trans isomerase (PPIase) that catalyzes the isomerization of prolyl imide peptide bonds and may contribute to protein folding. It plays a crucial role in pre-mRNA splicing and contributes to the formation of the U4/U5/U6 tri-snRNP complex in spliceosome assembly. PPIH Protein, Human (His) is the recombinant human-derived PPIH protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

PPIH Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ppih-protein-human-his.html

Purity

95.66

Smiles

MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM

Molecular Formula

10465 (Gene_ID) O43447-1 (M1-M177) (Accession)

Molecular Weight

Approximately 24.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC85C (NM_001144995) Human Over-expression Lysate
LY428630 100 µg

CCDC85C (NM_001144995) Human Over-expression Lysate

Sign In for Pricing
View Details
Txnrd1 Mouse Gene Knockout Kit (CRISPR)
KN518521 1 Kit

Txnrd1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1-Octanoyl-2-decanoyl-3-chloropropanediol
TRC-O238460-10MG 10 mg

1-Octanoyl-2-decanoyl-3-chloropropanediol

Sign In for Pricing
View Details
NDUFB10 Antibody
OC-528-01 50 μL

NDUFB10 Antibody

Sign In for Pricing
View Details
NDUFB10 Antibody
OC-528-02 100 µL

NDUFB10 Antibody

Sign In for Pricing
View Details
NDUFB10 Antibody
OC-528-03 1 mL

NDUFB10 Antibody

Sign In for Pricing
View Details