Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPIH, Human (His)

The PPIH protein is a peptidyl prolyl cis-trans isomerase (PPIase) that catalyzes the isomerization of prolyl imide peptide bonds and may contribute to protein folding. It plays a crucial role in pre-mRNA splicing and contributes to the formation of the U4/U5/U6 tri-snRNP complex in spliceosome assembly. PPIH Protein, Human (His) is the recombinant human-derived PPIH protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

PPIH Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ppih-protein-human-his.html

Purity

95.66

Smiles

MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM

Molecular Formula

10465 (Gene_ID) O43447-1 (M1-M177) (Accession)

Molecular Weight

Approximately 24.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Easypro Human IL-29 (Interleukin 29) ELISA Kit
FY-EH2614S 96 Well

Easypro Human IL-29 (Interleukin 29) ELISA Kit

Sign In for Pricing
View Details
Krtap5-5 siRNA Oligos set (Mouse)
26202174 3x 5 nmol

Krtap5-5 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Human UPF0443 protein C11orf75, C11orf75 ELISA Kit
MBS9331193-01 48 Well

Human UPF0443 protein C11orf75, C11orf75 ELISA Kit

Sign In for Pricing
View Details
Human UPF0443 protein C11orf75, C11orf75 ELISA Kit
MBS9331193-02 96 Well

Human UPF0443 protein C11orf75, C11orf75 ELISA Kit

Sign In for Pricing
View Details
Human UPF0443 protein C11orf75, C11orf75 ELISA Kit
MBS9331193-03 5x 96 Well

Human UPF0443 protein C11orf75, C11orf75 ELISA Kit

Sign In for Pricing
View Details
Human UPF0443 protein C11orf75, C11orf75 ELISA Kit
MBS9331193-04 10x 96 Well

Human UPF0443 protein C11orf75, C11orf75 ELISA Kit

Sign In for Pricing
View Details