Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HAS2, Mouse (His)

The HAS2 protein adds GlcNAc or GlcUA monosaccharides to hyaluronic acid, playing a crucial role in its synthesis. HAS2 Protein, Mouse (His) is the recombinant mouse-derived HAS2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

HAS2 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/has2-protein-mouse-his.html

Purity

95.00

Smiles

EHRKMKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQSVKRLTYPGIKVVMVIDGNSDDDLYMMDIFSEVMGRDKSATYIWKNNFHEKGPGETEESHKESSQHVTQLVLSNKSICIMQKWGGKREVMYTAFRALGRSVDYVQVCDSDTMLDPASSVEMVKVLEEDPMVGGVGGDVQILNKYDSWISFLSSVRYWMAFNIERACQSYFGCVQCISGPLGMYRNSLLHEFVEDWYNQEFMGNQCSFGDDRHLTNRVLSLGYATKYTARSKCLTETPIEYLRWLNQQTRWSKSYFREWLYNAMWFHKHHL

Molecular Formula

15117 (Gene_ID) P70312 (E67-L374) (Accession)

Molecular Weight

Approximately 36-38 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr747-set siRNA/shRNA/RNAi Lentivector (Mouse)
33416094 4x 500 ng

Olfr747-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Rhpn1 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3922004 1.0 µg DNA

Rhpn1 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
PCD19 rabbit pAb
ES14239-01 50 µL

PCD19 rabbit pAb

Sign In for Pricing
View Details
PCD19 rabbit pAb
ES14239-02 100 µL

PCD19 rabbit pAb

Sign In for Pricing
View Details
6-Propylchrysene
sc-476838 5 mg

6-Propylchrysene

Sign In for Pricing
View Details
SLC6A16 Antibody
orb356823-01 50 µg

SLC6A16 Antibody

Sign In for Pricing
View Details