Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HAS2, Mouse (His)

The HAS2 protein adds GlcNAc or GlcUA monosaccharides to hyaluronic acid, playing a crucial role in its synthesis. HAS2 Protein, Mouse (His) is the recombinant mouse-derived HAS2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

HAS2 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/has2-protein-mouse-his.html

Purity

95.00

Smiles

EHRKMKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQSVKRLTYPGIKVVMVIDGNSDDDLYMMDIFSEVMGRDKSATYIWKNNFHEKGPGETEESHKESSQHVTQLVLSNKSICIMQKWGGKREVMYTAFRALGRSVDYVQVCDSDTMLDPASSVEMVKVLEEDPMVGGVGGDVQILNKYDSWISFLSSVRYWMAFNIERACQSYFGCVQCISGPLGMYRNSLLHEFVEDWYNQEFMGNQCSFGDDRHLTNRVLSLGYATKYTARSKCLTETPIEYLRWLNQQTRWSKSYFREWLYNAMWFHKHHL

Molecular Formula

15117 (Gene_ID) P70312 (E67-L374) (Accession)

Molecular Weight

Approximately 36-38 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Sars Envelope Protein Antibody [DyLight 680]
NBP2-41062FR 0.1 mL

Rabbit Polyclonal Sars Envelope Protein Antibody [DyLight 680]

Sign In for Pricing
View Details
Human POTEE Pre-designed siRNA Set B
SI012574B 1 Each

Human POTEE Pre-designed siRNA Set B

Sign In for Pricing
View Details
Human Alpha-1-antitrypsin (SERPINA1) ELISA Kit
AE20069HU-01 48 Tests

Human Alpha-1-antitrypsin (SERPINA1) ELISA Kit

Sign In for Pricing
View Details
Human Alpha-1-antitrypsin (SERPINA1) ELISA Kit
AE20069HU-02 96 Tests

Human Alpha-1-antitrypsin (SERPINA1) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Granzyme B (GZMB)
CSB-YP010082HU-01 20 µg

Recombinant Human Granzyme B (GZMB)

Sign In for Pricing
View Details
Recombinant Human Granzyme B (GZMB)
CSB-YP010082HU-02 100 µg

Recombinant Human Granzyme B (GZMB)

Sign In for Pricing
View Details