Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HAS2, Mouse (His)

The HAS2 protein adds GlcNAc or GlcUA monosaccharides to hyaluronic acid, playing a crucial role in its synthesis. HAS2 Protein, Mouse (His) is the recombinant mouse-derived HAS2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

HAS2 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/has2-protein-mouse-his.html

Purity

95.00

Smiles

EHRKMKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQSVKRLTYPGIKVVMVIDGNSDDDLYMMDIFSEVMGRDKSATYIWKNNFHEKGPGETEESHKESSQHVTQLVLSNKSICIMQKWGGKREVMYTAFRALGRSVDYVQVCDSDTMLDPASSVEMVKVLEEDPMVGGVGGDVQILNKYDSWISFLSSVRYWMAFNIERACQSYFGCVQCISGPLGMYRNSLLHEFVEDWYNQEFMGNQCSFGDDRHLTNRVLSLGYATKYTARSKCLTETPIEYLRWLNQQTRWSKSYFREWLYNAMWFHKHHL

Molecular Formula

15117 (Gene_ID) P70312 (E67-L374) (Accession)

Molecular Weight

Approximately 36-38 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caspase-10 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-0092R-BF405 100 µL

Caspase-10 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Telethonin siRNA (h)
sc-36638 10 µM

Telethonin siRNA (h)

Sign In for Pricing
View Details
RPL21P26 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV777542 1.0 µg DNA

RPL21P26 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
GREM2 (Gremlin-2, Cysteine Knot Superfamily 1, BMP Antagonist 2, DAN Domain Family Member 3, Protein Related to DAN and Cerberus, CKTSF1B2, DAND3, PRDC, FLJ21195) (Not for Export EU)
127535 100 µL

GREM2 (Gremlin-2, Cysteine Knot Superfamily 1, BMP Antagonist 2, DAN Domain Family Member 3, Protein Related to DAN and Cerberus, CKTSF1B2, DAND3, PRDC, FLJ21195) (Not for Export EU)

Sign In for Pricing
View Details
Anti-Human CD16 Antibody (3G8), APC
FHC35013 100 Tests

Anti-Human CD16 Antibody (3G8), APC

Sign In for Pricing
View Details
AMIGO1 AAV siRNA Pooled Vector
11837161 1.0 µg

AMIGO1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details