Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCV-type II Chemokine-like, Virus

MCV-type II Chemokine-like Protein, Virus is the recombinant Virus-derived MCV-type II Chemokine-like protein, expressed by E. coli, with tag free.

Product Specifications

Product Name Alternative

MCV-type II Chemokine-like Protein, Virus, Virus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mcv-type-ii-chemokine-like-protein-virus.html

Purity

98.00

Smiles

LSRRKCCLNPTNRPIPRPLLQDLDKVDYQPMGHDCGREAFRVTLQDGRQGCVSVGNQSLLDWLKGHKDLCPRMWPGCESL

Molecular Formula

/ (Gene_ID) O41924/AAB72041 (L25-L104) (Accession)

Molecular Weight

Approximately 10 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Kallikrein 7 (KLK7) ELISA Kit
EIA07877r 1 Kit

Rat Kallikrein 7 (KLK7) ELISA Kit

Sign In for Pricing
View Details
Rat Monoclonal MICL/CLEC12A Antibody (812303) [DyLight 350]
FAB2950D 0.1 mL

Rat Monoclonal MICL/CLEC12A Antibody (812303) [DyLight 350]

Sign In for Pricing
View Details
FAF1 discontinued
388968 200 µL

FAF1 discontinued

Sign In for Pricing
View Details
PHLDB2 (NM_145753) Human Tagged ORF Clone
RG215783 10 µg

PHLDB2 (NM_145753) Human Tagged ORF Clone

Sign In for Pricing
View Details
NOBOX Recombinant Protein (Mouse)
RP154475 100 µg

NOBOX Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Ensa (NM_001033974) Rat Tagged ORF Clone Lentiviral Particle
RR200331L4V 200 µL

Ensa (NM_001033974) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details