Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cold-inducible RNA-binding protein (CIRBP)

Product Specifications

Product Name Alternative

A18 hnRNP (Glycine-rich RNA-binding protein CIRP) (A18HNRNP) (CIRP)

Abbreviation

Recombinant Human CIRBP protein

Gene Name

CIRBP

UniProt

Q14011

Expression Region

1-172aa

Organism

Homo sapiens (Human)

Target Sequence

MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. Acts as a translational activator. Seems to play an essential role in cold-induced suppression of cell proliferation. Binds specifically to the 3'-untranslated regions of stress-responsive transcripts RPA2 and TXN. Acts as a translational repressor (By similarity) . Promotes assembly of stress granules, when overexpressed.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

22.6 kDa

References & Citations

"Post-transcriptional regulation of thioredoxin by the stress inducible heterogeneous ribonucleoprotein A18." Yang R., Weber D.J., Carrier F. Nucleic Acids Res. 34:1224-1236 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cd4 Rat Monoclonal Antibody [Clone ID: YTS191.1]
SM005PT 25 µg

Cd4 Rat Monoclonal Antibody [Clone ID: YTS191.1]

Sign In for Pricing
View Details
Human Vanin 1 (VNN1) CLIA Kit
abx493784-01 96 Tests

Human Vanin 1 (VNN1) CLIA Kit

Sign In for Pricing
View Details
Human Vanin 1 (VNN1) CLIA Kit
abx493784-02 5x 96 Tests

Human Vanin 1 (VNN1) CLIA Kit

Sign In for Pricing
View Details
Human Vanin 1 (VNN1) CLIA Kit
abx493784-03 10x 96 Tests

Human Vanin 1 (VNN1) CLIA Kit

Sign In for Pricing
View Details
Zfp184 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4059106 1.0 µg DNA

Zfp184 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
MTTP/MTP Antibody
MBS9524473-01 0.04 mL

MTTP/MTP Antibody

Sign In for Pricing
View Details