Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADCYAP1R1, Human (HEK293, hFc)

The ADCYAP1R1 protein is a receptor for pituitary adenylate cyclase-activating polypeptide (PACAP) and recognizes PACAP-27 and PACAP-38. Through the G protein, this receptor activates adenylyl cyclase, initiating multiple downstream signaling pathways. ADCYAP1R1 Protein, Human (HEK293, hFc) is the recombinant human-derived ADCYAP1R1 protein, expressed by HEK293, with C-hFc labeled tag.

Product Specifications

Product Name Alternative

ADCYAP1R1 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/adcyap1r1-protein-human-hek293-hfc.html

Purity

95.00

Smiles

MHSDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRIFNPDQVWETETIGESDFGDSNSLDLSDMGVVSRNCTEDGWSEPFPHYFDACGFDEYESETGDQDYYYLSVKA

Molecular Formula

117 (Gene_ID) P41586 (M21-A155) (Accession)

Molecular Weight

Approximately 60-70 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DRD5 Blocking Peptide
MBS9626579-01 1 mg

DRD5 Blocking Peptide

Sign In for Pricing
View Details
DRD5 Blocking Peptide
MBS9626579-02 5x 1 mg

DRD5 Blocking Peptide

Sign In for Pricing
View Details
7-Hydroxycannabidivarin-d7
HY-157060S 1 mg

7-Hydroxycannabidivarin-d7

Sign In for Pricing
View Details
Anti-cPLA2 beta/PLA2G4B Antibody
MBS1753826-01 0.01 mg

Anti-cPLA2 beta/PLA2G4B Antibody

Sign In for Pricing
View Details
Anti-cPLA2 beta/PLA2G4B Antibody
MBS1753826-02 0.1 mg (Carrier Free)

Anti-cPLA2 beta/PLA2G4B Antibody

Sign In for Pricing
View Details
Anti-cPLA2 beta/PLA2G4B Antibody
MBS1753826-03 0.1 mg

Anti-cPLA2 beta/PLA2G4B Antibody

Sign In for Pricing
View Details