Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF R beta, Rat (HEK293, Fc)

PDGF R beta Protein, a receptor tyrosine kinase, binds ligands PDGFA, PDGFB, and PDGFD, forming homodimers or heterodimers.Ligand binding activates diverse signaling cascades in PDGF R beta, with responses contingent on the specific ligand.The modulation of responses involves heterodimer formation with another receptor, PDGFRB.PDGF R beta Protein, Rat (HEK293, Fc) is the recombinant rat-derived PDGF R beta protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

PDGF R beta Protein, Rat (HEK293, Fc), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdgf-r-beta-protein-rat-hek293-fc.html

Purity

95.0

Smiles

LVITPPGPEFVLNISSTFVLTCSSSAPVMWEQMSQVPWQEAAMNQDGTFSSVLTLTNVTGGDTGEYFCVYNNSLGPELSERKRIYIFVPDPTMGFLPMDSEDLFIFVTDVTETTIPCRVTDPQLEVTLHEKKVDIPLHVPYDHQRGFIGTFEDKTYICKTTIGDREVDSDTYYVYSLQVSSINVSVNAVQTVVRQGESITIRCIVMGNDVVNFQWTYPRMKSGRLVEPVTDYLFGVPSRIGSILHIPTAELSDSGTYTCNVSVSVNDHGDEKAINVTVIENGYVRLLETLEDVQIAELHRSRTLQVVFEAYPTPSVLWFKDNRTLGDSSAGELVLSTRNVSETRYVSELTLVRVKVSEAGYYTMRAFHADDQVQLSFKLQVNVPVRVLELSESHPANGEQILRCRGRGMPQPNVTWSTCRDLKRCPRKLSPTPLGNSSKEESQLETNVTFWEEDQEYEVVSTLRLRHVDQPLSVRCMLQNSMGRDSQEVTVVPHSLPFK

Molecular Formula

24629 (Gene_ID) Q05030 (L32-K530) (Accession)

Molecular Weight

Approximately 117 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPANXN3 Mouse Monoclonal Antibody [Clone ID: OTI1B2]
CF809110 100 µg

SPANXN3 Mouse Monoclonal Antibody [Clone ID: OTI1B2]

Sign In for Pricing
View Details
DOCK2 Rabbit Polyclonal Antibody
TA375577 100 µL

DOCK2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RBM3 (NM_006743) Human Recombinant Protein
TP760298 50 µg

RBM3 (NM_006743) Human Recombinant Protein

Sign In for Pricing
View Details
Boldenone Hemisuccinate
TRC-B675145-50MG 50 mg

Boldenone Hemisuccinate

Sign In for Pricing
View Details
PE Anti-Mouse Ly6C Antibody
RD21510F-01 25 µg

PE Anti-Mouse Ly6C Antibody

Sign In for Pricing
View Details
PE Anti-Mouse Ly6C Antibody
RD21510F-02 100 µg

PE Anti-Mouse Ly6C Antibody

Sign In for Pricing
View Details