Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

M-CSF, Human (Tag free, HEK293)

The M-CSF protein is an important cytokine that modulates hematopoietic precursor cells, especially mononuclear phagocytes, affecting innate immunity and inflammation through the release of proinflammatory chemokines. It is essential for osteoclast proliferation and regulates bone resorption, bone development and fertility. M-CSF Protein, Human (Tag free, HEK293) is the recombinant human-derived M-CSF protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

M-CSF Protein, Human (Tag free, HEK293), Human, HEK293

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/m-csf-protein-human-tag-free-hek293.html

Purity

95.0

Smiles

EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCN

Molecular Formula

1435 (Gene_ID) P09603-1 (E33-N190) (Accession)

Molecular Weight

Approximately 23-28 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANGPTL6 (Angiopoietin-related Protein 6, Angiopoietin-like Protein 6, Angiopoietin-related Growth Factor, Angiopoietin-related Protein 5, UNQ152/PRO178, AGF, ARP5) (AP) discontinued
123325-AP 100 µL

ANGPTL6 (Angiopoietin-related Protein 6, Angiopoietin-like Protein 6, Angiopoietin-related Growth Factor, Angiopoietin-related Protein 5, UNQ152/PRO178, AGF, ARP5) (AP) discontinued

Sign In for Pricing
View Details
FCER1A Rabbit pAb, Pacific Blue conjugated
orb2838429 100 µL

FCER1A Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
METT5D1 sgRNA CRISPR Lentivector set (Human)
K1292801 3x 1.0 µg

METT5D1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Saudin
MBS5784041 Inquire

Saudin

Sign In for Pricing
View Details
KCTD15, CT (KCTD15, BTB/POZ domain-containing protein KCTD15) (AP)
MBS6312852-01 0.2 mL

KCTD15, CT (KCTD15, BTB/POZ domain-containing protein KCTD15) (AP)

Sign In for Pricing
View Details
KCTD15, CT (KCTD15, BTB/POZ domain-containing protein KCTD15) (AP)
MBS6312852-02 5x 0.2 mL

KCTD15, CT (KCTD15, BTB/POZ domain-containing protein KCTD15) (AP)

Sign In for Pricing
View Details