Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Pericentrin (Pcnt), partial

Product Specifications

Product Name Alternative

Pcnt2

Abbreviation

Recombinant Mouse Pcnt protein, partial

Gene Name

Pcnt

UniProt

P48725

Expression Region

2545-2810aa

Organism

Mus musculus (Mouse)

Target Sequence

LCAAGLLTSFTNHTVDRTIKDWTSSNEKAVSSLMRTLEELKSELSMPTSFQKKMTAELQVQLMNELLSDNDALTKAVGMATREKAELCRTVSRLEKTLKHHTQKGCVLNRQSKSSLKQDGTDLQSSLRHSDPEWHSQTTSGDTNTCNIKMEKLYLHYLRAESFRKALIYQKKYLLLLIGGFQDSEQETLSMIAHLGVFPSKADKKITMSRPFTKFRTAVRVVIAVLRLRFLVKKWQEVDRKGALVHPKSTRHGHRTSQRQRSPSGP

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Tags & Cell Markers

Relevance

Integral component of the filamentous matrix of the centrosome involved in the initial establishment of organized microtubule arrays in both mitosis and meiosis. Plays a role, together with DISC1, in the microtubule network formation. Is an integral component of the pericentriolar material. May play an important role in preventing premature centrosome splitting during interphase by inhibiting NEK2 kinase activity at the centrosome.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

37.7 kDa

References & Citations

"LIS1 regulates CNS lamination by interacting with mNudE, a central component of the centrosome." Feng Y., Olson E.C., Stukenberg P.T., Flanagan L.A., Kirschner M.W., Walsh C.A. Neuron 28:665-679 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LentimiRa-Off-hsa-miR-6831-3p Vector
mh32337 500 ng

LentimiRa-Off-hsa-miR-6831-3p Vector

Sign In for Pricing
View Details
Dengue NS1 antibody
10-2698 1 mg

Dengue NS1 antibody

Sign In for Pricing
View Details
Human Growth Arrest-Specific Protein 1 ELISA Kit
IHUGAS1KT 1 Each

Human Growth Arrest-Specific Protein 1 ELISA Kit

Sign In for Pricing
View Details
Recombinant Azotobacter vinelandii Ferredoxin-like protein in nif region
MBS1136916-01 0.02 mg (E-Coli)

Recombinant Azotobacter vinelandii Ferredoxin-like protein in nif region

Sign In for Pricing
View Details
Recombinant Azotobacter vinelandii Ferredoxin-like protein in nif region
MBS1136916-02 0.1 mg (E-Coli)

Recombinant Azotobacter vinelandii Ferredoxin-like protein in nif region

Sign In for Pricing
View Details
Recombinant Azotobacter vinelandii Ferredoxin-like protein in nif region
MBS1136916-03 0.02 mg (Yeast)

Recombinant Azotobacter vinelandii Ferredoxin-like protein in nif region

Sign In for Pricing
View Details