Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD300LF, Mouse (HEK293, Fc)

The CD300LF protein, also known as DEC-205/CD205, directs antigens to the antigen-processing compartment. It inhibits myeloid cells and mast cells and promotes phagocytosis of apoptotic cells. CD300LF Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD300LF protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

CD300LF Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd300lf-protein-mouse-hek293-fc.html

Purity

95.00

Smiles

EDPVTGPEEVSGQEQGSLTVQCRYTSGWKDYKKYWCQGVPQRSCKTLVETDASEQLVKKNRVSIRDNQRDFIFTVTMEDLRMSDAGIYWCGITKGGLDPMFKVTVNIGPAIQVPITVPTMPPITSTTTIFTVTTTVKETSMFPTLTSYYSDNGHGGGDSGGGEDGVGDGFLDLS

Molecular Formula

246746 (Gene_ID) Q6SJQ7 (E20-S193) (Accession)

Molecular Weight

Approximately 45.3 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp746 (NM_001163475) Mouse Tagged ORF Clone Lentiviral Particle
MR215970L4V 200 µL

Zfp746 (NM_001163475) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Anti-POT1 Antibody Picoband®
PB9780 100 µg/Vial

Anti-POT1 Antibody Picoband®

Sign In for Pricing
View Details
FGF-16 Lentiviral Activation Particles (h2)
sc-411217-LAC-2 200 µL

FGF-16 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Anti-LHX4 Antibody Picoband®, Dylight594 Conjugate
A05503-1-Dylight594 100 µg

Anti-LHX4 Antibody Picoband®, Dylight594 Conjugate

Sign In for Pricing
View Details
2- (1H-1,3-Benzodiazol-1-yl) -5-fluorobenzoic acid
WTB30662-01 50 mg

2- (1H-1,3-Benzodiazol-1-yl) -5-fluorobenzoic acid

Sign In for Pricing
View Details
2- (1H-1,3-Benzodiazol-1-yl) -5-fluorobenzoic acid
WTB30662-02 0.5 g

2- (1H-1,3-Benzodiazol-1-yl) -5-fluorobenzoic acid

Sign In for Pricing
View Details