Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-1, Mouse (HEK293)

TIMP-1 is a metalloproteinase inhibitor that irreversibly inactivates collagenase and other metalloproteinases by binding to their catalytic zinc cofactor.It regulates MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16 and affects cellular processes such as differentiation, migration and cell death.TIMP-1 Protein, Mouse (HEK293) is the recombinant mouse-derived TIMP-1 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

TIMP-1 Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-1-protein-mouse-hek-293.html

Purity

98.00

Smiles

CSCAPPHPQTAFCNSDLVIRAKFMGSPEINETTLYQRYKIKMTKMLKGFKAVGNAADIRYAYTPVMESLCGYAHKSQNRSEEFLITGRLRNGNLHISACSFLVPWRTLSPAQQRAFSKTYSAGCGVCTVFPCLSIPCKLESDTHCLWTDQVLVGSEDYQSRHFACLPRNPGLCTWRSLGAR

Molecular Formula

21857 (Gene_ID) P12032 (C25-R205) (Accession)

Molecular Weight

Approximately 26.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IL-23 Protein (Fc Tag)
PDMH100317-01 20 µg

Recombinant Human IL-23 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human IL-23 Protein (Fc Tag)
PDMH100317-02 100 µg

Recombinant Human IL-23 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human IL-23 Protein (Fc Tag)
PDMH100317-03 500 µg

Recombinant Human IL-23 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human IL-23 Protein (Fc Tag)
PDMH100317-04 1 mg

Recombinant Human IL-23 Protein (Fc Tag)

Sign In for Pricing
View Details
Rab6 (BC019118) Mouse Tagged ORF Clone
MG202223 10 µg

Rab6 (BC019118) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Oleandrin
TRC-O258000-1MG 1 mg

Oleandrin

Sign In for Pricing
View Details