Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-1, Mouse (HEK293)

TIMP-1 is a metalloproteinase inhibitor that irreversibly inactivates collagenase and other metalloproteinases by binding to their catalytic zinc cofactor.It regulates MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16 and affects cellular processes such as differentiation, migration and cell death.TIMP-1 Protein, Mouse (HEK293) is the recombinant mouse-derived TIMP-1 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

TIMP-1 Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-1-protein-mouse-hek-293.html

Purity

98.00

Smiles

CSCAPPHPQTAFCNSDLVIRAKFMGSPEINETTLYQRYKIKMTKMLKGFKAVGNAADIRYAYTPVMESLCGYAHKSQNRSEEFLITGRLRNGNLHISACSFLVPWRTLSPAQQRAFSKTYSAGCGVCTVFPCLSIPCKLESDTHCLWTDQVLVGSEDYQSRHFACLPRNPGLCTWRSLGAR

Molecular Formula

21857 (Gene_ID) P12032 (C25-R205) (Accession)

Molecular Weight

Approximately 26.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCAM / MUC18 / Mucin 18 / CD146 (MCAM/1101), CF647 conjugate, 0.1mg/mL
BNC471101-100 1x 100 µL

MCAM / MUC18 / Mucin 18 / CD146 (MCAM/1101), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PDCD1 / PD1 / CD279 (Programmed Cell Death 1) (PDCD1/2720), CF568 conjugate, 0.1mg/mL
BNC682720-100 1x 100 µL

PDCD1 / PD1 / CD279 (Programmed Cell Death 1) (PDCD1/2720), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human ZNF221 activation kit by CRISPRa
GA105242 1 Kit

Human ZNF221 activation kit by CRISPRa

Sign In for Pricing
View Details
CARD11 Human Gene Knockout Kit (CRISPR)
KN222740 1 Kit

CARD11 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
N-(5-amino-4-(3-(3-cyclohexylureido)-1-(pyrazine-2-carbonyl)pyrrolidine-2-carboxamido)-5-oxopentyl)pyrazine-2-carboxamide
TRC-C558300-10MG 10 mg

N-(5-amino-4-(3-(3-cyclohexylureido)-1-(pyrazine-2-carbonyl)pyrrolidine-2-carboxamido)-5-oxopentyl)pyrazine-2-carboxamide

Sign In for Pricing
View Details
9H-Hexadecafluorononanoic Acid
TRC-H290043-500MG 500 mg

9H-Hexadecafluorononanoic Acid

Sign In for Pricing
View Details