Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-1, Mouse (HEK293)

TIMP-1 is a metalloproteinase inhibitor that irreversibly inactivates collagenase and other metalloproteinases by binding to their catalytic zinc cofactor.It regulates MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16 and affects cellular processes such as differentiation, migration and cell death.TIMP-1 Protein, Mouse (HEK293) is the recombinant mouse-derived TIMP-1 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

TIMP-1 Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-1-protein-mouse-hek-293.html

Purity

98.00

Smiles

CSCAPPHPQTAFCNSDLVIRAKFMGSPEINETTLYQRYKIKMTKMLKGFKAVGNAADIRYAYTPVMESLCGYAHKSQNRSEEFLITGRLRNGNLHISACSFLVPWRTLSPAQQRAFSKTYSAGCGVCTVFPCLSIPCKLESDTHCLWTDQVLVGSEDYQSRHFACLPRNPGLCTWRSLGAR

Molecular Formula

21857 (Gene_ID) P12032 (C25-R205) (Accession)

Molecular Weight

Approximately 26.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERAS Antibody (HRP)
orb242849-01 50 µg

ERAS Antibody (HRP)

Sign In for Pricing
View Details
ERAS Antibody (HRP)
orb242849-02 100 µg

ERAS Antibody (HRP)

Sign In for Pricing
View Details
Human SNX5 Recombinant Protein Liquid 50UG
IHUSNX5SNX5R50UG 50 µg

Human SNX5 Recombinant Protein Liquid 50UG

Sign In for Pricing
View Details
IL-9 Rabbit mAb, unconjugated, detector
E2RB20088UD 100 µL

IL-9 Rabbit mAb, unconjugated, detector

Sign In for Pricing
View Details
EED Antibody
CSB-PA007408GA01HU 100 µL

EED Antibody

Sign In for Pricing
View Details
Anti-HOXD9 Rabbit pAb
GB114507-50 50 μL

Anti-HOXD9 Rabbit pAb

Sign In for Pricing
View Details