Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSTA3, Human (His)

The TSTA3 protein plays a key role in catalyzing the two-step NADP-dependent conversion of GDP-4-dehydro-6-deoxy-D-mannose to GDP-fucose. The process involves successive epimerase and reductase reactions, ultimately leading to the biosynthesis of GDP-fucose. TSTA3 Protein, Human (His) is the recombinant human-derived TSTA3 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TSTA3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tsta3-protein-human-his.html

Smiles

MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQFKKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQARK

Molecular Formula

7264 (Gene_ID) Q13630 (M1-K321) (Accession)

Molecular Weight

Approximately 40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibrinogen gamma chain Antibody, FITC Conjugated
bs-6895R-FITC-01 20 µL

Fibrinogen gamma chain Antibody, FITC Conjugated

Sign In for Pricing
View Details
Fibrinogen gamma chain Antibody, FITC Conjugated
bs-6895R-FITC-02 100 µL

Fibrinogen gamma chain Antibody, FITC Conjugated

Sign In for Pricing
View Details
Rabbit Anti-Phospho-Dab1 (Ser491) antibody
SL3116R-01 50 µL

Rabbit Anti-Phospho-Dab1 (Ser491) antibody

Sign In for Pricing
View Details
Rabbit Anti-Phospho-Dab1 (Ser491) antibody
SL3116R-02 100 µL

Rabbit Anti-Phospho-Dab1 (Ser491) antibody

Sign In for Pricing
View Details
C1orf83 Protein Vector (Human) (pPM-C-HA)
PV005787 500 ng

C1orf83 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Factor XI light chain Rabbit pAb
E47R9502 100 µL

Factor XI light chain Rabbit pAb

Sign In for Pricing
View Details