Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSTA3, Human (His)

The TSTA3 protein plays a key role in catalyzing the two-step NADP-dependent conversion of GDP-4-dehydro-6-deoxy-D-mannose to GDP-fucose. The process involves successive epimerase and reductase reactions, ultimately leading to the biosynthesis of GDP-fucose. TSTA3 Protein, Human (His) is the recombinant human-derived TSTA3 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TSTA3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tsta3-protein-human-his.html

Smiles

MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQFKKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQARK

Molecular Formula

7264 (Gene_ID) Q13630 (M1-K321) (Accession)

Molecular Weight

Approximately 40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TRPM5 Protein Lysate (Human) with C-Ha Tag
48524031 100 µg

TRPM5 Protein Lysate (Human) with C-Ha Tag

Ask
View Details
CDH3 (Cadherin 3, Cadherin-3, Placental Cadherin, P-cadherin, CDHP) (MaxLight 490)
MBS6399894-01 0.1 mL

CDH3 (Cadherin 3, Cadherin-3, Placental Cadherin, P-cadherin, CDHP) (MaxLight 490)

Ask
View Details
CDH3 (Cadherin 3, Cadherin-3, Placental Cadherin, P-cadherin, CDHP) (MaxLight 490)
MBS6399894-02 5x 0.1 mL

CDH3 (Cadherin 3, Cadherin-3, Placental Cadherin, P-cadherin, CDHP) (MaxLight 490)

Ask
View Details
Mouse Interleukin-1RA AssayLite™ Antibody (FITC Conjugate)
36805-05141 2x 75 µg

Mouse Interleukin-1RA AssayLite™ Antibody (FITC Conjugate)

Ask
View Details
Monkey Elastase 2A (ELA2A) ELISA Kit
MBS9904370-01 48 Well

Monkey Elastase 2A (ELA2A) ELISA Kit

Ask
View Details
Monkey Elastase 2A (ELA2A) ELISA Kit
MBS9904370-02 96 Well

Monkey Elastase 2A (ELA2A) ELISA Kit

Ask
View Details