Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas aeruginosa Exotoxin A regulatory protein (toxR)

Product Specifications

Abbreviation

Recombinant Pseudomonas aeruginosa toxR protein

Gene Name

ToxR

UniProt

P09852

Expression Region

1-259aa

Organism

Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

Target Sequence

MTATDRTPPPLKWLCLGNRDANDGFELFAHGIYARNGALVGSKLSLRERRQRVDLSAFLSGAPPLLAEAAVKHLLARLLCVHRHNTDLELLGKNFIPLHASSLGNAGVCERILASARQLQQHQVELCLLLAIDEQEPASAEYLTSLARLRDSGVRIALHPQRIDTDARQCFAEVDAGLCDYLGLDARLLAPGPLTRNLRQRKSIEYLNRLLVAQDIQMLCLNVDNEELHQQANALPFAFRHGRHYSEPFQAWPFSSPAC

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Positive regulation of toxA gene transcription.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

32.9 kDa

References & Citations

"Expression of the Pseudomonas aeruginosa toxA positive regulatory gene (regA) in Escherichia coli." Hamood A., Iglewski B.H. J. Bacteriol. 172:589-594 (1990)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD44 Antibody-AF647 labled
MBS8321947-01 25 Assays

Anti-CD44 Antibody-AF647 labled

Sign In for Pricing
View Details
Anti-CD44 Antibody-AF647 labled
MBS8321947-02 100 Assays

Anti-CD44 Antibody-AF647 labled

Sign In for Pricing
View Details
Anti-CD44 Antibody-AF647 labled
MBS8321947-03 5x 100 Assays

Anti-CD44 Antibody-AF647 labled

Sign In for Pricing
View Details
Human TATA box binding protein/TBP-associated factors, TAF ELISA Kit
CK-bio-13619-01 48 Tests

Human TATA box binding protein/TBP-associated factors, TAF ELISA Kit

Sign In for Pricing
View Details
Human TATA box binding protein/TBP-associated factors, TAF ELISA Kit
CK-bio-13619-02 96 Tests

Human TATA box binding protein/TBP-associated factors, TAF ELISA Kit

Sign In for Pricing
View Details
Human TATA box binding protein/TBP-associated factors, TAF ELISA Kit
CK-bio-13619-03 5x 96 Tests

Human TATA box binding protein/TBP-associated factors, TAF ELISA Kit

Sign In for Pricing
View Details