PPY, Human (HEK293, His)
PPY, a pancreatic hormone, regulates pancreatic and gastrointestinal functions. Its action may involve signaling through the G protein-coupled receptor NPY4R2, coordinating processes for homeostasis in both systems. PPY Protein, Human (HEK293, His) is the recombinant human-derived PPY protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
PPY Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ppy-protein-human-hek-293-his.html
Purity
95.0
Smiles
APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRYGKRHKEDTLAFSEWGSPHAAVPR
Molecular Formula
5539 (Gene_ID) P01298 (A30-R88) (Accession)
Molecular Weight
12-14 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880034-500 1x 500 µL
Cytokeratin 8/18 (C-51), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040012-100 1x 100 µL
Tyrosinase (T311), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400257-100 1x 100 µL
Cytokeratin, HMW (AE-3), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400026-500 1x 500 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040270-500 1x 500 µL
Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740745-100 1x 100 µL
CD45 / LCA (2B11 + PD7/26), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details