Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPY, Human (HEK293, His)

PPY, a pancreatic hormone, regulates pancreatic and gastrointestinal functions. Its action may involve signaling through the G protein-coupled receptor NPY4R2, coordinating processes for homeostasis in both systems. PPY Protein, Human (HEK293, His) is the recombinant human-derived PPY protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PPY Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ppy-protein-human-hek-293-his.html

Purity

95.0

Smiles

APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRYGKRHKEDTLAFSEWGSPHAAVPR

Molecular Formula

5539 (Gene_ID) P01298 (A30-R88) (Accession)

Molecular Weight

12-14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fam24a 3'UTR Luciferase Stable Cell Line
TU106248 1.0 mL

Fam24a 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
B7RP-1 siRNA (m)
sc-42769 10 µM

B7RP-1 siRNA (m)

Sign In for Pricing
View Details
Wedelolactone
AB0240 20 mg

Wedelolactone

Sign In for Pricing
View Details
KiSS-1R Polyclonal Antibody
E20-72480 100 µg

KiSS-1R Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Rhesus Macaque CCL5 Protein, His (Fc)-Avi-tagged
CCL5-521R 50 µg

Recombinant Rhesus Macaque CCL5 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
ZNF81, NT (ZNF81, Zinc finger protein 81, HFZ20) (Biotin) discontinued
044376-Biotin 200 µL

ZNF81, NT (ZNF81, Zinc finger protein 81, HFZ20) (Biotin) discontinued

Sign In for Pricing
View Details