Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Nogo-B receptor (Nus1), partial

Product Specifications

Product Name Alternative

(Nogo-B receptor) (NgBR) (Nuclear undecaprenyl pyrophosphate synthase 1 homolog)

Abbreviation

Recombinant Mouse Nus1 protein, partial

Gene Name

Nus1

UniProt

Q99LJ8

Expression Region

140-297aa

Organism

Mus musculus (Mouse)

Target Sequence

DHQGIFKRNNSRLMDEILKQQQELLGQDCSKYSAEFANSNDKDDQDLNCPSAVKVLSPEDGKADIVRAAQDFCQLVAQQQRKPTDLDVDLLGSLLSSHGFPDPDLVLKFGPVDSTLGFLPWQIRLTEIVSLPSHLNISYEDFFSALRQYAACEQRLGK

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

With DHDDS, forms the dehydrodolichyl diphosphate synthase (DDS) complex, an essential component of the dolichol monophosphate (Dol-P) biosynthetic machinery. Both subunits contribute to enzymatic activity, i.e. condensation of multiple copies of isopentenyl pyrophosphate (IPP) to farnesyl pyrophosphate (FPP) to produce dehydrodolichyl diphosphate (Dedol-PP), a precursor of dolichol phosphate which is utilized as a sugar carrier in protein glycosylation in the endoplasmic reticulum (ER) . Synthesizes long-chain polyprenols, mostly of C95 and C100 chain length. Regulates the glycosylation and stability of nascent NPC2, thereby promoting trafficking of LDL-derived cholesterol. Acts as a specific receptor for the N-terminus of Nogo-B, a neural and cardiovascular regulator.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.2 kDa

References & Citations

"The transcriptional landscape of the mammalian genome."Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral mouse Gm10639 shRNA (UAS) - Lentiviral mouse Gm10639 shRNA (UAS, GFP) plasmid
GTR15214594 1 Vial

Lentiviral mouse Gm10639 shRNA (UAS) - Lentiviral mouse Gm10639 shRNA (UAS, GFP) plasmid

Ask
View Details
MT ND5 (ND5) Rabbit Polyclonal Antibody
AP21196PU-N 100 µg

MT ND5 (ND5) Rabbit Polyclonal Antibody

Ask
View Details
CD48 (BCM1, BCM1 surface antigen, BLAST, BLAST1, B-lymphocyte activation marker BLAST-1, CD48 antigen precursor, hCD48, Leucocyte antigen MEM-102, Leukocyte antigen MEM-102, mCD48, MEM-102, SLAMF2, TCT.1)
C2403-09J 100 µg

CD48 (BCM1, BCM1 surface antigen, BLAST, BLAST1, B-lymphocyte activation marker BLAST-1, CD48 antigen precursor, hCD48, Leucocyte antigen MEM-102, Leukocyte antigen MEM-102, mCD48, MEM-102, SLAMF2, TCT.1)

Ask
View Details
Recombinant Swine Cadherin-3 (CDH3), N-SUMOSTAR
AP9C115-01 1 mg

Recombinant Swine Cadherin-3 (CDH3), N-SUMOSTAR

Ask
View Details
Recombinant Swine Cadherin-3 (CDH3), N-SUMOSTAR
AP9C115-02 100 µg

Recombinant Swine Cadherin-3 (CDH3), N-SUMOSTAR

Ask
View Details
Recombinant Swine Cadherin-3 (CDH3), N-SUMOSTAR
AP9C115-03 20 µg

Recombinant Swine Cadherin-3 (CDH3), N-SUMOSTAR

Ask
View Details