Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRO-alpha/CXCL1, Human

CXCL1 (Chemokine (C-X-C motif) ligand 1), also known as GRO alpha, NAP-3 or MGSA, belongs to the sub-family of CXC chemokine. CXCL1 is involved in the development of many inflammatory diseases, including the induction of angiogenesis and recruitment of neutrophils. CXCL1 is produced by many cell types, and activates CXCR2 and, at high levels, CXCR1[1]. GRO-alpha/CXCL1 Protein, Human is produced in E. coli, and consists of 73 amino acids (A35-N107) .

Product Specifications

Product Name Alternative

GRO-alpha/CXCL1 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gro-alpha-cxcl1-protein-human.html

Purity

95.00

Smiles

ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN

Molecular Formula

2919 (Gene_ID) P09341 (A35-N107) (Accession)

Molecular Weight

Approximately 7.8 kDa

References & Citations

[1]Dhawan P, et al. Role of CXCL1 in tumorigenesis of melanoma. J Leukoc Biol. 2002 Jul;72 (1) :9-18.|[2]Haskill S, et al. Identification of three related human GRO genes encoding cytokine functions. Proc Natl Acad Sci U S A. 1990 Oct;87 (19) :7732-6.|[3]Moser B, et al. Neutrophil-activating properties of the melanoma growth-stimulatory activity. J Exp Med. 1990 May 1;171 (5) :1797-802.|[4]Vries MH, et al. CXCL1 promotes arteriogenesis through enhanced monocyte recruitment into the peri-collateral space. Angiogenesis. 2015 Apr;18 (2) :163-71.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-AU1 Antibody
18818 1mg

Anti-AU1 Antibody

Sign In for Pricing
View Details
Rat Monoclonal PDGF R alpha Antibody (RM0004-3G28)
NB110-61020 0.1 mg

Rat Monoclonal PDGF R alpha Antibody (RM0004-3G28)

Sign In for Pricing
View Details
Lentiviral mouse Pnliprp2 shRNA (UAS) - Lentiviral mousePnliprp2 shRNA (UAS, GFP) (25)
GTR15102356 1 Vial

Lentiviral mouse Pnliprp2 shRNA (UAS) - Lentiviral mousePnliprp2 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS520353 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Munc18-1 Rabbit pAb
orb2718868-01 50 µL

Munc18-1 Rabbit pAb

Sign In for Pricing
View Details
Munc18-1 Rabbit pAb
orb2718868-02 100 µL

Munc18-1 Rabbit pAb

Sign In for Pricing
View Details