CD82, Human (HEK293, Fc)
CD82, a vital immune response participant, engages with CD4 or CD8 to provide crucial costimulatory signals in the TCR/CD3 pathway. Its direct interaction with IGSF8 plays a pivotal role in modulating immune functions and mediating cellular responses. CD82 Protein, Human (HEK293, Fc) is the recombinant human-derived CD82 protein, expressed by HEK293 , with N-hFc labeled tag.
Product Specifications
Product Name Alternative
CD82 Protein, Human (HEK293, Fc), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd82-protein-human-hek-293-fc.html
Purity
95.0
Smiles
GALFYFNMGKLKQEMGGIVTELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQ
Molecular Formula
3732 (Gene_ID) P27701-1 (G103-Q225) (Accession)
Molecular Weight
40-60 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
BAFF Receptor (TNFRSF13C) (NM_052945) Human Untagged Clone
TP53 (Tumor Suppressor p53, Cellular Tumor Antigen p53, TRP53, Antigen NY-CO-13, BCC7, LFS1, Phosphoprotein p53) (MaxLight 405)
TP53 (Tumor Suppressor p53, Cellular Tumor Antigen p53, TRP53, Antigen NY-CO-13, BCC7, LFS1, Phosphoprotein p53) (MaxLight 405)
RPP40 (NM_006638) Human Over-expression Lysate