Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNMT, Human (His)

The HNMT protein plays a pivotal role in histamine metabolism, facilitating its inactivation through N-methylation. This enzymatic activity is crucial for histamine degradation, emphasizing HNMT's essential function in modulating histamine levels. Its involvement in regulating the airway response to histamine underscores its significance in maintaining physiological homeostasis, potentially impacting immune and inflammatory responses. HNMT Protein, Human (His) is the recombinant human-derived HNMT protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

HNMT Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hnmt-protein-human-gst.html

Purity

96.00

Smiles

MASSMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVCINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWHKETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWDKLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYECYDLLSTMDISDCFIDGNENGDLLWDFLTETCNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA

Molecular Formula

3176 (Gene_ID) AAH20677.1 (M1-A292) (Accession)

Molecular Weight

Approximately 32 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral mouse Prr15 shRNA (UAS) - Lentiviral mouse Prr15 shRNA (UAS, RFP) (25)
GTR15260663 1 Vial

Lentiviral mouse Prr15 shRNA (UAS) - Lentiviral mouse Prr15 shRNA (UAS, RFP) (25)

Ask
View Details
Mfsd7b (Flvcr1) (NM_001081259) Mouse Tagged Lenti ORF Clone
MR221296L3 10 µg

Mfsd7b (Flvcr1) (NM_001081259) Mouse Tagged Lenti ORF Clone

Ask
View Details
Lentiviral human PFKL shRNA (UAS) - Lentiviral human PFKL shRNA (UAS) (25)
GTR15099197 1 Vial

Lentiviral human PFKL shRNA (UAS) - Lentiviral human PFKL shRNA (UAS) (25)

Ask
View Details
GPR111 (ADGRF2) (Center) Rabbit Polyclonal Antibody
AP51896PU-N 400 µL

GPR111 (ADGRF2) (Center) Rabbit Polyclonal Antibody

Ask
View Details