Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cellular communication network factor 6 (Ccn6)

Product Specifications

Product Name Alternative

(CCN family member 6) (WNT1-inducible-signaling pathway protein 3) (WISP-3)

Abbreviation

Recombinant Mouse Ccn6 protein

Gene Name

Ccn6

UniProt

D3Z5L9

Expression Region

24-354aa

Organism

Mus musculus (Mouse)

Target Sequence

SAPQDSTPGGRPGAALEVYQRTEVCRWPCRCPPQRPTCPPGVSLVRDGCGCCKVCAKQPGDTCNEAEICDPHKGLYCDYSGDTPRYETGVCAYLVAVGCEFNRVYYQNGQVFQPHPLFSCLCVSGAIGCTPLFIPKLAGSNCSAAKGRRKTDPPNCGRGTLQQQNSASYKTMSAYRNLPLTWRKKCLVQATKWTPCSRTCGMGISNRVTNDNANCEMRKERRLCYIQPCSRNTSQAVKIPRGETCQPTFQLPKAEKFVFSGCSSTQSYRPTFCGICLDKRCCVPNKSKMITVRFDCPSEGSFKWQMLWVTSCVCQRDCREPGDIFSELRIL

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Plays a role in mitochondrial electron transport and mitochondrial respiration.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

42.8 kDa

References & Citations

"WISP3, the gene responsible for the human skeletal disease progressive pseudorheumatoid dysplasia, is not essential for skeletal function in mice." Kutz W.E., Gong Y., Warman M.L. Mol. Cell. Biol. 25:414-421 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Guinea Pig IgG (H&L) Antibody (AcalephFluor350)
orb2990627-01 100 µL

Rabbit Anti-Guinea Pig IgG (H&L) Antibody (AcalephFluor350)

Sign In for Pricing
View Details
Rabbit Anti-Guinea Pig IgG (H&L) Antibody (AcalephFluor350)
orb2990627-02 500 µL

Rabbit Anti-Guinea Pig IgG (H&L) Antibody (AcalephFluor350)

Sign In for Pricing
View Details
Rabbit Anti-Guinea Pig IgG (H&L) Antibody (AcalephFluor350)
orb2990627-03 1 mL

Rabbit Anti-Guinea Pig IgG (H&L) Antibody (AcalephFluor350)

Sign In for Pricing
View Details
TXNDC13 (TMX4) CytoSection
TS407480P5 25 Slides

TXNDC13 (TMX4) CytoSection

Sign In for Pricing
View Details
Mouse Monoclonal SHP-1 Antibody (PTPN6/7544) [mFluor Violet 450 SE]
NBP3-27000MFV450 0.1 mL

Mouse Monoclonal SHP-1 Antibody (PTPN6/7544) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Rat Soluble Factor-Related Apoptosis (sFAS/sAPO-1) ELISA Kit
orb1947874-01 48 Tests

Rat Soluble Factor-Related Apoptosis (sFAS/sAPO-1) ELISA Kit

Sign In for Pricing
View Details